UniGene Name: uma_v2.0_unigene29062
Length: 243 nt
UniGene Fasta |
---|
>uma_v2.0_unigene29062
A |
Ace file of the UniGene uma_v2.0_unigene29062 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Parent Assembly | Parent UniGene | Reads (related/total) |
---|---|---|
SustainPine v2.0 | sp_v2.0_unigene11882 | 2/2 |
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | callose synthase 12 [Arabidopsis thaliana] sp|Q9ZT82.1|CALSC_ARATH RecName: Full=Callose synthase 12; AltName: Full=1,3-beta-glucan synthase; AltName: Full=Protein GLUCAN SYNTHASE-LIKE 5; AltName: Full=Protein POWDERY MILDEW RESISTANT 4 gb|AAD11597.1| put | - | - | 0.0 | 68% |
FL-Next | sp=Callose synthase 11; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 59% |
Blast2go | callose synthase 11-like | - | - | 0.0 | 78% |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | 1,3-beta-glucan synthase. | EC:2.4.1.34 | - | 0.0 | 78% |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | Starch and sucrose metabolism | 00500 | 0.0 | 78% |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | (1->3)-beta-D-glucan biosynthetic process | GO:0006075 | Biological Process | 0.0 | 78% |
Blast2go | defense response to bacterium | GO:0042742 | Biological Process | 0.0 | 78% |
Blast2go | leaf morphogenesis | GO:0009965 | Biological Process | 0.0 | 78% |
Blast2go | reproduction | GO:0000003 | Biological Process | 0.0 | 78% |
Blast2go | defense response signaling pathway, resistance gene-dependent | GO:0009870 | Biological Process | 0.0 | 78% |
Blast2go | circadian rhythm | GO:0007623 | Biological Process | 0.0 | 78% |
Blast2go | defense response by callose deposition in cell wall | GO:0052544 | Biological Process | 0.0 | 78% |
Blast2go | pollen development | GO:0009555 | Biological Process | 0.0 | 78% |
Blast2go | salicylic acid mediated signaling pathway | GO:0009863 | Biological Process | 0.0 | 78% |
Blast2go | leaf senescence | GO:0010150 | Biological Process | 0.0 | 78% |
Blast2go | defense response to fungus | GO:0050832 | Biological Process | 0.0 | 78% |
Blast2go | 1,3-beta-D-glucan synthase activity | GO:0003843 | Molecular Function | 0.0 | 78% |
Blast2go | 1,3-beta-D-glucan synthase complex | GO:0000148 | Cellular Component | 0.0 | 78% |
Blast2go | cytoplasmic membrane-bounded vesicle | GO:0016023 | Cellular Component | 0.0 | 78% |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Peptidase M14, carboxypeptidase A | IPR000834 | - | 0.0 | - |
Sma3 | F-box domain, cyclin-like | IPR001810 | - | 0.0 | - |
Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
Sma3 | Glycosyl transferase, family 48 | IPR003440 | - | 0.0 | - |
Sma3 | K Homology domain | IPR004087 | - | 0.0 | - |
Sma3 | K Homology domain, type 1 | IPR004088 | - | 0.0 | - |
Sma3 | ABC transporter, conserved site | IPR017871 | - | 0.0 | - |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q9S9U0
Fln msg: Distance to subject end: 660 aas, your sequence is shorter than subject: 80 - 1768
Fln protein:
N
Protein Length:
81
Fln nts:
A
Fln Alignment:
uma_mira_c21841___PNPNTEIC----GIDILLEGNEDAKALMKFTYVVTCQIYGAQKAKQDNHAKDILYLMKNYEALRIAYVDEV
Q9S9U0________________PTPSQEISRMASGITHLLKGSEYGSAMMKFTYVVACQVYGQHKARGDHRAEEILFLMKNHDALRIAYVDEV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain