UniGene Name: biog2_v2.0_unigene18020
Length: 207 nt
UniGene Fasta |
---|
>biog2_v2.0_unigene18020
A |
Ace file of the UniGene biog2_v2.0_unigene18020 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Parent Assembly | Parent UniGene | Reads (related/total) |
---|---|---|
SustainPine v2.0 | sp_v2.0_unigene7956 | 2/2 |
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | putative Ubiquitin activating enzyme [Oryza sativa Japonica Group] dbj|BAG88369.1| unnamed protein product [Oryza sativa Japonica Group] | - | - | 0.0 | 68% |
FL-Next | sp=Ubiquitin-like modifier-activating enzyme 5; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 94% |
Blast2go | ubiquitin-like modifier-activating enzyme | - | - | 0.0 | 78% |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | Oxidoreductases, Acting on the CH-OH group of donors, With NAD(+) or NADP(+) as acceptor. | EC:1.1.1.- | - | 0.0 | 78% |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | metabolic process | GO:0008152 | Biological Process | 0.0 | 78% |
Blast2go | cofactor binding | GO:0048037 | Molecular Function | 0.0 | 78% |
Blast2go | oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor | GO:0016616 | Molecular Function | 0.0 | 78% |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | UBA/THIF-type NAD/FAD binding fold | IPR000594 | - | 0.0 | - |
Sma3 | D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding | IPR006140 | - | 0.0 | - |
Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: O23034
Fln msg: Distance to subject end: 281 aas, your sequence is shorter than subject: 68 - 431
Fln protein:
F
Protein Length:
69
Fln nts:
A
Fln Alignment:
biogeco2_mira_c16939___AAEMLARCGIGRLLLYDYDTVELANMNRLFFRPEQVGMTKTDAAAQTLAEINPD
O23034__________________AAEMLTRCGIGRLLLYDYDTVELANMNRLFFRPDQVGMTKTDAAVQTLAEINPD
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain