|
||||||
|
UniGene Name: biog2_v2.0_unigene17592
Length: 206 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >biog2_v2.0_unigene17592
A |
|
Ace file of the UniGene biog2_v2.0_unigene17592 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Parent Assembly | Parent UniGene | Reads (related/total) |
|---|---|---|
| SustainPine v2.0 | sp_v2.0_unigene234 | 2/2 |
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Receptor-like kinase n=1 Tax=Marchantia polymorpha RepID=A7VM43_MARPO | - | - | 0.0 | 74% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 43% |
| Blast2go | probably inactive leucine-rich repeat receptor-like protein kinase at3g28040-like | - | - | 0.0 | 83% |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | [Tau protein] kinase. | EC:2.7.11.26 | - | 0.0 | 83% |
| Blast2go | [G-protein-coupled receptor] kinase. | EC:2.7.11.16 | - | 0.0 | 83% |
| Blast2go | 2-alkenal reductase. | EC:1.3.1.74 | - | 0.0 | 83% |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | 83% |
| Blast2go | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | 83% |
| Blast2go | tau-protein kinase activity | GO:0050321 | Molecular Function | 0.0 | 83% |
| Blast2go | receptor activity | GO:0004872 | Molecular Function | 0.0 | 83% |
| Blast2go | ATP binding | GO:0005524 | Molecular Function | 0.0 | 83% |
| Blast2go | G-protein coupled receptor kinase activity | GO:0004703 | Molecular Function | 0.0 | 83% |
| Blast2go | 2-alkenal reductase [NAD(P)] activity | GO:0032440 | Molecular Function | 0.0 | 83% |
| Blast2go | cytoplasmic membrane-bounded vesicle | GO:0016023 | Cellular Component | 0.0 | 83% |
| Blast2go | integral to membrane | GO:0016021 | Cellular Component | 0.0 | 83% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LN40
Fln msg: Distance to subject end: 236 aas, your sequence is shorter than subject: 68 - 340
Fln protein:
G
Protein Length:
69
Fln nts:
A
Fln Alignment:
biogeco2_mira_c15472___GTVYKAVLGDGRVVAIKKLMVSSLVKSQEDFEKEIQLLRRIKHPNLVNLQGYYWTPQLQLLIYDYI
B8LN40__________________GTAYKAVLEDGTTVVVKRL--KDVAANRKDFEQQMELVGRIRHRNLVPLRAFYYSKDEKLLVYDYM
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
