|
||||||
|
UniGene Name: biog2_v2.0_unigene17294
Length: 172 nt
 UniGene Fasta
|
|---|
| >biog2_v2.0_unigene17294
A |
|
Ace file of the UniGene biog2_v2.0_unigene17294
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Parent Assembly | Parent UniGene | Reads (related/total) |
|---|---|---|
| SustainPine v2.0 | sp_v2.0_unigene3780 | 2/2 |
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Inositol monophosphatase - like protein [Arabidopsis thaliana] | - | - | 0.0 | 66% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 82% |
| Blast2go | inositol monophosphatase - like protein | - | - | 0.0 | 83% |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Histidinol-phosphatase. | EC:3.1.3.15 | - | 0.0 | 83% |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Histidine metabolism | 00340 | 0.0 | 83% | |
| Blast2go | Biosynthesis of alkaloids derived from histidine and purine | 01065 | 0.0 | 83% | |
| Blast2go | Metabolic pathways | 01100 | 0.0 | 83% | |
| Blast2go | Biosynthesis of secondary metabolites | 01110 | 0.0 | 83% | |
| Blast2go | 3'(2'),5'-bisphosphate nucleotidase. | EC:3.1.3.7 | - | 0.0 | 83% |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Sulfur metabolism | 00920 | 0.0 | 83% | |
| Blast2go | Metabolic pathways | 01100 | 0.0 | 83% | |
| Blast2go | Inositol-phosphate phosphatase. | EC:3.1.3.25 | - | 0.0 | 83% |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Inositol phosphate metabolism | 00562 | 0.0 | 83% | |
| Blast2go | Metabolic pathways | 01100 | 0.0 | 83% | |
| Blast2go | Biosynthesis of secondary metabolites | 01110 | 0.0 | 83% | |
| Blast2go | Phosphatidylinositol signaling system | 04070 | 0.0 | 83% |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | sulfur compound metabolic process | GO:0006790 | Biological Process | 0.0 | 83% |
| Blast2go | histidine biosynthetic process | GO:0000105 | Biological Process | 0.0 | 83% |
| Blast2go | histidinol-phosphatase activity | GO:0004401 | Molecular Function | 0.0 | 83% |
| Blast2go | L-galactose-1-phosphate phosphatase activity | GO:0010347 | Molecular Function | 0.0 | 83% |
| Blast2go | 3'(2'),5'-bisphosphate nucleotidase activity | GO:0008441 | Molecular Function | 0.0 | 83% |
| Blast2go | inositol monophosphate 1-phosphatase activity | GO:0008934 | Molecular Function | 0.0 | 83% |
| Blast2go | chloroplast | GO:0009507 | Cellular Component | 0.0 | 83% |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Histidinol-phosphate phosphatase, putative, inositol monophosphatase | IPR011809 | - | 0.0 | - |
| Sma3 | Inositol monophosphatase | IPR000760 | - | 0.0 | - |
| Full-Lengther Next Prediction |
|---|
Fln status: Putative N-terminus
Fln database: coniferopsida.fasta
Fln subject: A9NXM4
Fln msg: Distance to subject end: 296 aas, atg_distance in limit (1-15): atg_distance = 3, W2: There is no M at the beginning, your sequence is shorter than subject: 56 - 355
Fln protein:
I
Protein Length:
57
Fln nts:
A
Fln Alignment:
biogeco2_mira_c15111___ISSLSYATSSTAIDFPNFQLNRHSRKPPSPSANFFSHYSFSKRPASLNSVGCSLYR
A9NXM4__________________ISSLSHATSPTAINFPNSQLNKLSRKPPFPSANFCLHYSFSKRPASLNWVGCSLYR
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
