UniGene Name: biog2_v2.0_unigene16027
Length: 248 nt
UniGene Fasta
|
|---|
| >biog2_v2.0_unigene16027
T |
Ace file of the UniGene biog2_v2.0_unigene16027
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Parent Assembly | Parent UniGene | Reads (related/total) |
|---|---|---|
| SustainPine v2.0 | sp_v2.0_unigene56504 | 2/2 |
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | PREDICTED: tyrosine-protein kinase ABL1 n=1 Tax=Monodelphis domestica RepID=UPI00020F590D | - | - | 3.0e-28 | 100% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 49% |
| Blast2go | mutant bcr abl fusion protein | - | - | 1.6344e-37 | 99% |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Transferases, Transferring phosphorous-containing groups, Protein-tyrosine kinases. | EC:2.7.10.- | - | 1.6344e-37 | 99% |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | DNA damage induced protein phosphorylation | GO:0006975 | Biological Process | 1.6344e-37 | 99% |
| Blast2go | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 1.6344e-37 | 99% |
| Blast2go | actin cytoskeleton organization | GO:0030036 | Biological Process | 1.6344e-37 | 99% |
| Blast2go | peptidyl-tyrosine phosphorylation | GO:0018108 | Biological Process | 1.6344e-37 | 99% |
| Blast2go | positive regulation of oxidoreductase activity | GO:0051353 | Biological Process | 1.6344e-37 | 99% |
| Blast2go | positive regulation of muscle cell differentiation | GO:0051149 | Biological Process | 1.6344e-37 | 99% |
| Blast2go | multicellular organismal process | GO:0032501 | Biological Process | 1.6344e-37 | 99% |
| Blast2go | manganese ion binding | GO:0030145 | Molecular Function | 1.6344e-37 | 99% |
| Blast2go | mitogen-activated protein kinase binding | GO:0051019 | Molecular Function | 1.6344e-37 | 99% |
| Blast2go | protein C-terminus binding | GO:0008022 | Molecular Function | 1.6344e-37 | 99% |
| Blast2go | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 1.6344e-37 | 99% |
| Blast2go | proline-rich region binding | GO:0070064 | Molecular Function | 1.6344e-37 | 99% |
| Blast2go | magnesium ion binding | GO:0000287 | Molecular Function | 1.6344e-37 | 99% |
| Blast2go | SH3 domain binding | GO:0017124 | Molecular Function | 1.6344e-37 | 99% |
| Blast2go | ATP binding | GO:0005524 | Molecular Function | 1.6344e-37 | 99% |
| Blast2go | nucleolus | GO:0005730 | Cellular Component | 1.6344e-37 | 99% |
| Blast2go | cytosol | GO:0005829 | Cellular Component | 1.6344e-37 | 99% |
| Blast2go | perinuclear region of cytoplasm | GO:0048471 | Cellular Component | 1.6344e-37 | 99% |
| Blast2go | negative regulation of protein serine/threonine kinase activity | GO:0071901 | Biological Process | 1.6344e-37 | 99% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: C0PQ12
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 94 aas, your sequence is shorter than subject: 82 - 835
Fln protein:
L
Protein Length:
83
Fln nts:
T
Fln Alignment:
biogeco2_mira_c13557___RDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDV
C0PQ12__________________RDLKSSNLLVDKNWTVKVGDFGLSRLKNATFLTAKSGKGTP-QWMAPEVLRNEPSNEKSDV

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta