|
||||||
|
UniGene Name: biog2_v2.0_unigene15474
Length: 187 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >biog2_v2.0_unigene15474
G |
|
Ace file of the UniGene biog2_v2.0_unigene15474 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Parent Assembly | Parent UniGene | Reads (related/total) |
|---|---|---|
| SustainPine v2.0 | sp_v2.0_unigene11345 | 3/3 |
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Regulator of ribonuclease-like protein 3 [Arabidopsis thaliana] sp|Q9FH13.1|RRAA3_ARATH RecName: Full=Regulator of ribonuclease-like protein 3 dbj|BAB09117.1| S-adenosylmethionine:2-demethylmenaquinone methyltransferase-like [Arabidopsis thaliana] gb|AAR2 | - | - | 0.0 | 65% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 100% |
| Blast2go | regulator of ribonuclease activity | - | - | 0.0 | 81% |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Transferases, Transferring one-carbon groups, Methyltransferases. | EC:2.1.1.- | - | 0.0 | 81% |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | negative regulation of endoribonuclease activity | GO:0060702 | Biological Process | 0.0 | 81% |
| Blast2go | methylation | GO:0032259 | Biological Process | 0.0 | 81% |
| Blast2go | regulation of RNA metabolic process | GO:0051252 | Biological Process | 0.0 | 81% |
| Blast2go | endoribonuclease inhibitor activity | GO:0060698 | Molecular Function | 0.0 | 81% |
| Blast2go | enzyme binding | GO:0019899 | Molecular Function | 0.0 | 81% |
| Blast2go | methyltransferase activity | GO:0008168 | Molecular Function | 0.0 | 81% |
| Blast2go | cytoplasm | GO:0005737 | Cellular Component | 0.0 | 81% |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Ribonuclease E inhibitor RraA/Dimethylmenaquinone methyltransferase | IPR005493 | - | 0.0 | - |
| Sma3 | Regulator of ribonuclease activity A | IPR010203 | - | 0.0 | - |
| Full-Lengther Next Prediction |
|---|
Fln status: C-terminus
Fln database: coniferopsida.fasta
Fln subject: A9NMH8
Fln msg: your sequence is shorter than subject: 62 - 166
Fln protein:
D
Protein Length:
63
Fln nts:
G
Fln Alignment:
biogeco2_mira_c12886___DEINRCDIGVRALATHPLKSNKKGVGDKNGVVFIGGTRIAHGEWCCADSDGVIISPTELSL
A9NMH8__________________DEINRCDIGVRALATHPLKSNKKGVGDKNGVVFIGGTRIAHGEWCCADSDGVIISPTELSL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
