|
||||||
|
UniGene Name: biog2_v2.0_unigene15003
Length: 169 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >biog2_v2.0_unigene15003
T |
|
Ace file of the UniGene biog2_v2.0_unigene15003 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Parent Assembly | Parent UniGene | Reads (related/total) |
|---|---|---|
| SustainPine v2.0 | sp_v2.0_unigene7013 | 2/2 |
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Aspartate aminotransferase n=2 Tax=Pinaceae RepID=PAT_PINPS | - | - | 0.0 | 94% |
| FL-Next | sp=Aspartate aminotransferase; Pinus pinaster (Maritime pine). | - | - | 0.0 | 100% |
| Blast2go | aspartate aminotransferase | - | - | 0.0 | 88% |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Glutamate--prephenate aminotransferase. | EC:2.6.1.79 | - | 0.0 | 88% |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Biosynthesis of plant hormones | 01070 | 0.0 | 88% | |
| Blast2go | Aspartate transaminase. | EC:2.6.1.1 | - | 0.0 | 88% |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Alanine, aspartate and glutamate metabolism | 00250 | 0.0 | 88% | |
| Blast2go | Cysteine and methionine metabolism | 00270 | 0.0 | 88% | |
| Blast2go | Arginine and proline metabolism | 00330 | 0.0 | 88% | |
| Blast2go | Tyrosine metabolism | 00350 | 0.0 | 88% | |
| Blast2go | Phenylalanine metabolism | 00360 | 0.0 | 88% | |
| Blast2go | Phenylalanine, tyrosine and tryptophan biosynthesis | 00400 | 0.0 | 88% | |
| Blast2go | Carbon fixation in photosynthetic organisms | 00710 | 0.0 | 88% | |
| Blast2go | Isoquinoline alkaloid biosynthesis | 00950 | 0.0 | 88% | |
| Blast2go | Tropane, piperidine and pyridine alkaloid biosynthesis | 00960 | 0.0 | 88% | |
| Blast2go | Biosynthesis of phenylpropanoids | 01061 | 0.0 | 88% | |
| Blast2go | Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid | 01064 | 0.0 | 88% | |
| Blast2go | Biosynthesis of plant hormones | 01070 | 0.0 | 88% | |
| Blast2go | Metabolic pathways | 01100 | 0.0 | 88% | |
| Blast2go | Biosynthesis of secondary metabolites | 01110 | 0.0 | 88% | |
| Blast2go | 1-aminocyclopropane-1-carboxylate synthase. | EC:4.4.1.14 | - | 0.0 | 88% |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Cysteine and methionine metabolism | 00270 | 0.0 | 88% | |
| Blast2go | Biosynthesis of plant hormones | 01070 | 0.0 | 88% | |
| Blast2go | Metabolic pathways | 01100 | 0.0 | 88% | |
| Blast2go | Biosynthesis of secondary metabolites | 01110 | 0.0 | 88% |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | 1-aminocyclopropane-1-carboxylate biosynthetic process | GO:0042218 | Biological Process | 0.0 | 88% |
| Blast2go | glutamate-prephenate aminotransferase activity | GO:0033854 | Molecular Function | 0.0 | 88% |
| Blast2go | pyridoxal phosphate binding | GO:0030170 | Molecular Function | 0.0 | 88% |
| Blast2go | L-aspartate:2-oxoglutarate aminotransferase activity | GO:0004069 | Molecular Function | 0.0 | 88% |
| Blast2go | 1-aminocyclopropane-1-carboxylate synthase activity | GO:0016847 | Molecular Function | 0.0 | 88% |
| Blast2go | chloroplast | GO:0009507 | Cellular Component | 0.0 | 88% |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | 1-aminocyclopropane-1-carboxylate synthase | IPR001176 | - | 0.0 | - |
| Sma3 | Aminotransferase, class I/classII | IPR004839 | - | 0.0 | - |
| Sma3 | Aminotransferases, class-I, pyridoxal-phosphate-binding site | IPR004838 | - | 0.0 | - |
| Sma3 | Pyridoxal phosphate-dependent transferase, major region, subdomain 1 | IPR015421 | - | 0.0 | - |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: Q5F4K8
Fln msg: Distance to subject end: 221 aas, your sequence is shorter than subject: 55 - 492
Fln protein:
A
Protein Length:
56
Fln nts:
T
Fln Alignment:
biogeco2_mira_c12303___ADATPVIIPTLLSDDFLLNPEVFSSKLNENSRLLILCSPSNPTGSVYPRELLEEI
Q5F4K8__________________ADATPVIIPTLLSDDFLLNPEVFSSKLNENSRLLILCSPSNPTGSVYPRELLEEI
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
