UniGene Name: biog2_v2.0_unigene14954
Length: 181 nt
UniGene Fasta |
---|
>biog2_v2.0_unigene14954
G |
Ace file of the UniGene biog2_v2.0_unigene14954 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Parent Assembly | Parent UniGene | Reads (related/total) |
---|---|---|
SustainPine v2.0 | sp_v2.0_unigene5702 | 2/2 |
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Oxygenase (Fragment) n=2 Tax=Nicotiana RepID=O82031_TOBAC | - | - | 0.0 | 67% |
FL-Next | tr=Alpha-dioxygenase 1; Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress). | - | - | 0.0 | 65% |
Blast2go | prostaglandin g h synthase 2-like | - | - | 0.0 | 82% |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | NAD(P)H oxidase. | EC:1.6.3.1 | - | 0.0 | 82% |
Blast2go | Prostaglandin-endoperoxide synthase. | EC:1.14.99.1 | - | 0.0 | 82% |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | Arachidonic acid metabolism | 00590 | 0.0 | 82% | |
Blast2go | Metabolic pathways | 01100 | 0.0 | 82% | |
Blast2go | Peroxidase. | EC:1.11.1.7 | - | 0.0 | 82% |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | Phenylalanine metabolism | 00360 | 0.0 | 82% | |
Blast2go | Methane metabolism | 00680 | 0.0 | 82% | |
Blast2go | Phenylpropanoid biosynthesis | 00940 | 0.0 | 82% | |
Blast2go | Biosynthesis of phenylpropanoids | 01061 | 0.0 | 82% | |
Blast2go | Metabolic pathways | 01100 | 0.0 | 82% | |
Blast2go | Biosynthesis of secondary metabolites | 01110 | 0.0 | 82% | |
Blast2go | Oxidoreductases, Acting on single donors with incorporation of molecular oxygen, With incorporation of two atoms of oxygen. | EC:1.13.11.- | - | 0.0 | 82% |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | Benzoate degradation | 00362 | 0.0 | 82% | |
Blast2go | Tryptophan metabolism | 00380 | 0.0 | 82% | |
Blast2go | Arachidonic acid metabolism | 00590 | 0.0 | 82% | |
Blast2go | Xylene degradation | 00622 | 0.0 | 82% | |
Blast2go | Toluene degradation | 00623 | 0.0 | 82% | |
Blast2go | Polycyclic aromatic hydrocarbon degradation | 00624 | 0.0 | 82% | |
Blast2go | Naphthalene degradation | 00626 | 0.0 | 82% | |
Blast2go | Aminobenzoate degradation | 00627 | 0.0 | 82% | |
Blast2go | Nitrotoluene degradation | 00633 | 0.0 | 82% | |
Blast2go | Betalain biosynthesis | 00965 | 0.0 | 82% | |
Blast2go | Metabolic pathways | 01100 | 0.0 | 82% |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | 82% |
Blast2go | response to oxidative stress | GO:0006979 | Biological Process | 0.0 | 82% |
Blast2go | heme binding | GO:0020037 | Molecular Function | 0.0 | 82% |
Blast2go | NAD(P)H oxidase activity | GO:0016174 | Molecular Function | 0.0 | 82% |
Blast2go | prostaglandin-endoperoxide synthase activity | GO:0004666 | Molecular Function | 0.0 | 82% |
Blast2go | peroxidase activity | GO:0004601 | Molecular Function | 0.0 | 82% |
Blast2go | oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen | GO:0016702 | Molecular Function | 0.0 | 82% |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Haem peroxidase, animal | IPR002007 | - | 0.0 | - |
Sma3 | Haem peroxidase, animal, subgroup | IPR019791 | - | 0.0 | - |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: tr_plants
Fln subject: D7LAG3
Fln msg: Overlapping hits, possible frame ERROR between 134 and 116, Distance to subject end: 116 aas, your sequence is shorter than subject: 60 - 639
Fln protein:
H
Protein Length:
61
Fln nts:
G
Fln Alignment:
biogeco2_mira_c12245___PSGEDRPDHVDTPALEIYRDRERSVSRYNQFRAIxxxxxxAKWEDLTDDKEAIQTL
D7LAG3__________________PNGQDRPDHVDLAALEIYRDRERNVPRYNDFRRAxxxxxxTKWEDLTDDEEAIKVL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain