UniGene Name: biog2_v2.0_unigene14425
Length: 235 nt
UniGene Fasta |
---|
>biog2_v2.0_unigene14425
C |
Ace file of the UniGene biog2_v2.0_unigene14425 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Parent Assembly | Parent UniGene | Reads (related/total) |
---|---|---|
SustainPine v2.0 | sp_v2.0_unigene14642 | 2/2 |
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Serine/threonine protein kinase, putative n=1 Tax=Ricinus communis RepID=B9RKW8_RICCO | - | - | 0.0 | 73% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 52% |
Blast2go | phototropin 2 | - | - | 0.0 | 84% |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | Transferases, Transferring phosphorous-containing groups, Protein-serine/threonine kinases. | EC:2.7.11.- | - | 0.0 | 84% |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | cellular metabolic process | GO:0044237 | Biological Process | 0.0 | 84% |
Blast2go | stomatal movement | GO:0010118 | Biological Process | 0.0 | 84% |
Blast2go | phototropism | GO:0009638 | Biological Process | 0.0 | 84% |
Blast2go | negative regulation of anion channel activity by blue light | GO:0010362 | Biological Process | 0.0 | 84% |
Blast2go | blue light signaling pathway | GO:0009785 | Biological Process | 0.0 | 84% |
Blast2go | blue light photoreceptor activity | GO:0009882 | Molecular Function | 0.0 | 84% |
Blast2go | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | 84% |
Blast2go | identical protein binding | GO:0042802 | Molecular Function | 0.0 | 84% |
Blast2go | FMN binding | GO:0010181 | Molecular Function | 0.0 | 84% |
Blast2go | Golgi apparatus | GO:0005794 | Cellular Component | 0.0 | 84% |
Blast2go | plasma membrane | GO:0005886 | Cellular Component | 0.0 | 84% |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | PAS | IPR000014 | - | 0.0 | - |
Sma3 | PAS-associated, C-terminal | IPR000700 | - | 0.0 | - |
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | AGC-kinase, C-terminal | IPR000961 | - | 0.0 | - |
Sma3 | Legume lectin domain | IPR001220 | - | 0.0 | - |
Sma3 | Phytochrome | IPR001294 | - | 0.0 | - |
Sma3 | PAC motif | IPR001610 | - | 0.0 | - |
Sma3 | Serine/threonine- / dual-specificity protein kinase, catalytic domain | IPR002290 | - | 0.0 | - |
Sma3 | GAF domain | IPR003018 | - | 0.0 | - |
Sma3 | Domain of unknown function DUF591 | IPR007649 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | Phytochrome, central region | IPR013515 | - | 0.0 | - |
Sma3 | Phytochrome chromophore binding site | IPR013516 | - | 0.0 | - |
Sma3 | PAS fold-2 | IPR013654 | - | 0.0 | - |
Sma3 | PAS fold-3 | IPR013655 | - | 0.0 | - |
Sma3 | PAS fold | IPR013767 | - | 0.0 | - |
Sma3 | Phytochrome chromophore attachment domain | IPR016132 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - | |
Sma3 | Protein kinase, C-terminal | IPR017892 | - | 0.0 | - |
Sma3 | Tubulin, conserved site | IPR017975 | - | 0.0 | - |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LKY3
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 30 aas, your sequence is shorter than subject: 66 - 545
Fln protein:
Q
Protein Length:
67
Fln nts:
C
Fln Alignment:
biogeco2_mira_c11613___QNTFAKILHKDLTFPSSIPASLAARQLIHRLLHRDPANRLGSKSGAHEIKQHPFSVG
B8LKY3__________________RETLEKIAGQALRFPDSPTVSFAARDLIRGLLMKDPQHRLAFKRGATEIKQHPFFDG
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain