|
||||||
|
UniGene Name: biog2_v2.0_unigene13870
Length: 197 nt
 UniGene Fasta
|
|---|
| >biog2_v2.0_unigene13870
A |
|
Ace file of the UniGene biog2_v2.0_unigene13870
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Parent Assembly | Parent UniGene | Reads (related/total) |
|---|---|---|
| SustainPine v2.0 | sp_v2.0_unigene93 | 2/2 |
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | plant glycogenin-like starch initiation protein 6 [Arabidopsis thaliana] dbj|BAC43531.1| unknown protein [Arabidopsis thaliana] gb|AED92569.1| plant glycogenin-like starch initiation protein 6 [Arabidopsis thaliana] | - | - | 0.0 | 62% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 92% |
| Blast2go | plant glycogenin-like starch initiation protein 6 | - | - | 0.0 | 75% |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Transferases, Glycosyltransferases, Hexosyltransferases. | EC:2.4.1.- | - | 0.0 | 75% |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | carbohydrate biosynthetic process | GO:0016051 | Biological Process | 0.0 | 75% |
| Blast2go | transferase activity, transferring hexosyl groups | GO:0016758 | Molecular Function | 0.0 | 75% |
| Blast2go | cytoplasmic membrane-bounded vesicle | GO:0016023 | Cellular Component | 0.0 | 75% |
| Blast2go | membrane | GO:0016020 | Cellular Component | 0.0 | 75% |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glycosyl transferase, family 8 | IPR002495 | - | 0.0 | - |
| Full-Lengther Next Prediction |
|---|
Fln status: C-terminus
Fln database: coniferopsida.fasta
Fln subject: B8LLU5
Fln msg: your sequence is shorter than subject: 43 - 567
Fln protein:
W
Protein Length:
44
Fln nts:
A
Fln Alignment:
biogeco2_mira_c10930___GGGFVLVSFMTYASEHLAIRSFLKGREDRNLLNSRHLCCGF
B8LLU5__________________GGGLVLVSFMTYASEHLAIRSFLKGREDRNLLNSTYLCCGF
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
