UniGene Name: biog2_v2.0_unigene13471
Length: 221 nt
UniGene Fasta |
---|
>biog2_v2.0_unigene13471
T |
Ace file of the UniGene biog2_v2.0_unigene13471 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Parent Assembly | Parent UniGene | Reads (related/total) |
---|---|---|
SustainPine v2.0 | sp_v2.0_unigene1771 | 2/2 |
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | ATP sulfurylase 1 [Arabidopsis thaliana] sp|Q9LIK9.1|APS1_ARATH RecName: Full=ATP sulfurylase 1, chloroplastic; Short=AtPS1; Flags: Precursor gb|AAK43869.1|AF370492_1 ATP sulfurylase/APS kinase [Arabidopsis thaliana] dbj|BAB03034.1| ATP sulfurylase/APS ki | - | - | 0.0 | 71% |
FL-Next | sp=ATP sulfurylase 2; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 86% |
Blast2go | atp sulfurylase | - | - | 0.0 | 86% |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | Sulfate adenylyltransferase. | EC:2.7.7.4 | - | 0.0 | 86% |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | Purine metabolism | 00230 | 0.0 | 86% | |
Blast2go | Selenocompound metabolism | 00450 | 0.0 | 86% | |
Blast2go | Sulfur metabolism | 00920 | 0.0 | 86% | |
Blast2go | Metabolic pathways | 01100 | 0.0 | 86% | |
Blast2go | Glucose-1-phosphate adenylyltransferase. | EC:2.7.7.27 | - | 0.0 | 86% |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | Starch and sucrose metabolism | 00500 | 0.0 | 86% | |
Blast2go | Amino sugar and nucleotide sugar metabolism | 00520 | 0.0 | 86% | |
Blast2go | Metabolic pathways | 01100 | 0.0 | 86% |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | sulfate assimilation | GO:0000103 | Biological Process | 0.0 | 86% |
Blast2go | photoperiodism, flowering | GO:0048573 | Biological Process | 0.0 | 86% |
Blast2go | starch biosynthetic process | GO:0019252 | Biological Process | 0.0 | 86% |
Blast2go | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | 86% |
Blast2go | sulfate adenylyltransferase (ATP) activity | GO:0004781 | Molecular Function | 0.0 | 86% |
Blast2go | glucose-1-phosphate adenylyltransferase activity | GO:0008878 | Molecular Function | 0.0 | 86% |
Blast2go | sugar binding | GO:0005529 | Molecular Function | 0.0 | 86% |
Blast2go | heterotetrameric ADPG pyrophosphorylase complex | GO:0030931 | Cellular Component | 0.0 | 86% |
Blast2go | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | 86% |
Blast2go | plasma membrane | GO:0005886 | Cellular Component | 0.0 | 86% |
Blast2go | apoplast | GO:0048046 | Cellular Component | 0.0 | 86% |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Sulphate adenylyltransferase | IPR002650 | - | 0.0 | - |
Sma3 | Adenylylsulphate kinase | IPR002891 | - | 0.0 | - |
Sma3 | Inorganic pyrophosphatase | IPR008162 | - | 0.0 | - |
Sma3 | Rossmann-like alpha/beta/alpha sandwich fold | IPR014729 | - | 0.0 | - |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q43870
Fln msg: Separated hits, possible frame ERROR between 155 and 157, Distance to subject end: 190 aas, your sequence is shorter than subject: 73 - 476
Fln protein:
S
Protein Length:
74
Fln nts:
T
Fln Alignment:
biogeco2_mira_c10440___AGNWLIGGDLEVLERIKYNDGLDHYRLSPKELREEFEKREADAVFAFQLRxPVHNGHALLMTDTRRRLLEMG
Q43870__________________SGNWLIGGDLEVFEPIKYNDGLDHYRLSPKQLREEFDNRQADAVFAFQLRxPVHNGHALLMNDTRKRLLEMG
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain