UniGene Name: biog2_v2.0_unigene13128
Length: 206 nt
UniGene Fasta
|
|---|
| >biog2_v2.0_unigene13128
A |
Ace file of the UniGene biog2_v2.0_unigene13128
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Parent Assembly | Parent UniGene | Reads (related/total) |
|---|---|---|
| SustainPine v2.0 | sp_v2.0_unigene10683 | 1/2 |
| SustainPine v2.0 | sp_v2.0_unigene15857 | 1/2 |
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Cytochrome P450 obtusifoliol 14-alpha-demethylase n=2 Tax=Populus trichocarpa RepID=B9GMU7_POPTR | - | - | 0.0 | 82% |
| FL-Next | sp=Obtusifoliol 14-alpha demethylase; Sorghum bicolor (Sorghum) (Sorghum vulgare). | - | - | 0.0 | 80% |
| Blast2go | obtusifoliol 14alpha-demethylase | - | - | 0.0 | 90% |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | EC:1.14.13.7- | - | 0.0 | 90% | |
| Blast2go | Transferases, Transferring one-carbon groups, Methyltransferases. | EC:2.1.1.- | - | 0.0 | 90% |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | embryo development ending in seed dormancy | GO:0009793 | Biological Process | 0.0 | 90% |
| Blast2go | methylation | GO:0032259 | Biological Process | 0.0 | 90% |
| Blast2go | sterol biosynthetic process | GO:0016126 | Biological Process | 0.0 | 90% |
| Blast2go | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | 90% |
| Blast2go | sterol 14-demethylase activity | GO:0008398 | Molecular Function | 0.0 | 90% |
| Blast2go | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | 90% |
| Blast2go | heme binding | GO:0020037 | Molecular Function | 0.0 | 90% |
| Blast2go | oxygen binding | GO:0019825 | Molecular Function | 0.0 | 90% |
| Blast2go | methyltransferase activity | GO:0008168 | Molecular Function | 0.0 | 90% |
| Blast2go | plasma membrane | GO:0005886 | Cellular Component | 0.0 | 90% |
| Blast2go | integral to membrane | GO:0016021 | Cellular Component | 0.0 | 90% |
| Blast2go | endoplasmic reticulum | GO:0005783 | Cellular Component | 0.0 | 90% |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Ribosomal protein S9 | IPR000754 | - | 0.0 | - |
| Sma3 | Cytochrome P450 | IPR001128 | - | 0.0 | - |
| Sma3 | Cytochrome P450, E-class, group IV | IPR002403 | - | 0.0 | - |
| Sma3 | Transposon, En/Spm-like | IPR004242 | - | 0.0 | - |
| Sma3 | Ribosomal protein S5 domain 2-type fold, subgroup | IPR014721 | - | 0.0 | - |
| Sma3 | Cytochrome P450, conserved site | IPR017972 | - | 0.0 | - |
| Sma3 | IPR017973 | - | 0.0 | - |
Full-Lengther Next Prediction |
|---|
Fln status: C-terminus
Fln database: sp_plants
Fln subject: P93846
Fln msg: your sequence is shorter than subject: 62 - 492
Fln protein:
G
Protein Length:
63
Fln nts:
A
Fln Alignment:
biogeco2_mira_c10026___LQIKAIWTHLLRNFELELISPFPEIDWNAMVVGVKDKVMVRYRRRPLSVD
P93846__________________LQIKAIWTHLLRNFEFELVSPFPENDWNAMVVGIKGEVMVNYKRRKLVVD

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta