UniGene Name: biog2_v2.0_unigene12482
Length: 231 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense)
|
|---|
| >biog2_v2.0_unigene12482
A |
Ace file of the UniGene biog2_v2.0_unigene12482 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Parent Assembly | Parent UniGene | Reads (related/total) |
|---|---|---|
| SustainPine v2.0 | sp_v2.0_unigene546 | 1/2 |
| SustainPine v2.0 | sp_v2.0_unigene9522 | 1/2 |
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | SAL1 phosphatase n=5 Tax=Brassicaceae RepID=DPNP1_ARATH | - | - | 0.0 | 61% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 84% |
| Blast2go | 3 (2 ) -bisphosphate nucleotidase | - | - | 0.0 | 80% |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | 3'(2'),5'-bisphosphate nucleotidase. | EC:3.1.3.7 | - | 0.0 | 80% |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Sulfur metabolism | 00920 | 0.0 | 80% | |
| Blast2go | Metabolic pathways | 01100 | 0.0 | 80% |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | response to water deprivation | GO:0009414 | Biological Process | 0.0 | 80% |
| Blast2go | positive regulation of unidimensional cell growth | GO:0051512 | Biological Process | 0.0 | 80% |
| Blast2go | regulation of jasmonic acid biosynthetic process | GO:0080141 | Biological Process | 0.0 | 80% |
| Blast2go | negative regulation of signal transduction | GO:0009968 | Biological Process | 0.0 | 80% |
| Blast2go | miRNA catabolic process | GO:0010587 | Biological Process | 0.0 | 80% |
| Blast2go | photoperiodism, flowering | GO:0048573 | Biological Process | 0.0 | 80% |
| Blast2go | negative regulation of transcription, DNA-dependent | GO:0045892 | Biological Process | 0.0 | 80% |
| Blast2go | phosphatidylinositol-mediated signaling | GO:0048015 | Biological Process | 0.0 | 80% |
| Blast2go | sulfur compound metabolic process | GO:0006790 | Biological Process | 0.0 | 80% |
| Blast2go | response to cold | GO:0009409 | Biological Process | 0.0 | 80% |
| Blast2go | abscisic acid mediated signaling pathway | GO:0009738 | Biological Process | 0.0 | 80% |
| Blast2go | response to cation stress | GO:0043157 | Biological Process | 0.0 | 80% |
| Blast2go | inositol or phosphatidylinositol phosphatase activity | GO:0004437 | Molecular Function | 0.0 | 80% |
| Blast2go | 3'(2'),5'-bisphosphate nucleotidase activity | GO:0008441 | Molecular Function | 0.0 | 80% |
| Blast2go | nucleotide phosphatase activity | GO:0019204 | Molecular Function | 0.0 | 80% |
| Blast2go | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | 80% |
| Blast2go | nucleus | GO:0005634 | Cellular Component | 0.0 | 80% |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Inositol monophosphatase | IPR000760 | - | 0.0 | - |
| Sma3 | Thaumatin, pathogenesis-related | IPR001938 | - | 0.0 | - |
| Sma3 | Carbohydrate/puine kinase, PfkB, conserved site | IPR002173 | - | 0.0 | - |
| Sma3 | 3(2),5 -bisphosphate nucleotidase HAL2 | IPR006239 | - | 0.0 | - |
| Sma3 | ApaG domain | IPR007474 | - | 0.0 | - |
| Sma3 | Thaumatin, conserved site | IPR017949 | - | 0.0 | - |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NMF9
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 160 aas, your sequence is shorter than subject: 77 - 271
Fln protein:
S
Protein Length:
78
Fln nts:
A
Fln Alignment:
biogeco2_mira_c9260___QTARVKMENRAYEQDXXXXXXXXXXXXXLCQSVQKSLT-TDTQAKTDSSPVTVADYGSQALVSFVL
A9NMF9__________________KTTRAKMDIGAYEQDLAIAIKAASLAARLCQSVQKSLLQTDTQAKMDSSPVTVADYGSQALVSFVL

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta (sense)