|
||||||
|
UniGene Name: biog2_v2.0_unigene12044
Length: 227 nt
 UniGene Fasta
|
|---|
| >biog2_v2.0_unigene12044
T |
|
Ace file of the UniGene biog2_v2.0_unigene12044
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Parent Assembly | Parent UniGene | Reads (related/total) |
|---|---|---|
| SustainPine v2.0 | sp_v2.0_unigene27724 | 2/2 |
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | protein kinase family protein [Musa balbisiana] | - | - | 0.0 | 76% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 81% |
| Blast2go | protein kinase family protein | - | - | 0.0 | 85% |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | kinase activity | GO:0016301 | Molecular Function | 0.0 | 85% |
| Blast2go | plasma membrane | GO:0005886 | Cellular Component | 0.0 | 85% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: C0PRI9
Fln msg: Distance to subject end: 309 aas, your sequence is shorter than subject: 75 - 656
Fln protein:
F
Protein Length:
76
Fln nts:
T
Fln Alignment:
biogeco2_mira_c8728___FGCVYKGYLPDGQVVAVKQLKVGSGQGEREFRAEVEIISRVHHRHLVSLVGYCIADSQRLL
C0PRI9__________________FGYVYKGILPGSKTIAVKQLKVGGSQGEREFQAEVEIISRVHHRHLVSLVGYCIAGSQRLL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
