UniGene Name: biog2_v2.0_unigene12009
Length: 238 nt
UniGene Fasta |
---|
>biog2_v2.0_unigene12009
G |
Ace file of the UniGene biog2_v2.0_unigene12009 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Parent Assembly | Parent UniGene | Reads (related/total) |
---|---|---|
SustainPine v2.0 | sp_v2.0_unigene6018 | 2/2 |
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | 4-amino-4-deoxychorismate synthase n=2 Tax=Triticeae RepID=A4UIY9_WHEAT | - | - | 0.0 | 48% |
FL-Next | sp=Anthranilate synthase component I-2, chloroplastic; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 44% |
Blast2go | para-aminobenzoate synthase-like | - | - | 0.0 | 78% |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | Anthranilate synthase. | EC:4.1.3.27 | - | 0.0 | 78% |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | Phenylalanine, tyrosine and tryptophan biosynthesis | 00400 | 0.0 | 78% | |
Blast2go | Biosynthesis of phenylpropanoids | 01061 | 0.0 | 78% | |
Blast2go | Biosynthesis of alkaloids derived from shikimate pathway | 01063 | 0.0 | 78% | |
Blast2go | Biosynthesis of plant hormones | 01070 | 0.0 | 78% | |
Blast2go | Metabolic pathways | 01100 | 0.0 | 78% | |
Blast2go | Biosynthesis of secondary metabolites | 01110 | 0.0 | 78% | |
Blast2go | Aminodeoxychorismate synthase. | EC:2.6.1.85 | - | 0.0 | 78% |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | Folate biosynthesis | 00790 | 0.0 | 78% | |
Blast2go | Biosynthesis of phenylpropanoids | 01061 | 0.0 | 78% |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | glutamine metabolic process | GO:0006541 | Biological Process | 0.0 | 78% |
Blast2go | folic acid biosynthetic process | GO:0046656 | Biological Process | 0.0 | 78% |
Blast2go | para-aminobenzoic acid biosynthetic process | GO:0008153 | Biological Process | 0.0 | 78% |
Blast2go | chorismate metabolic process | GO:0046417 | Biological Process | 0.0 | 78% |
Blast2go | embryo development ending in seed dormancy | GO:0009793 | Biological Process | 0.0 | 78% |
Blast2go | anthranilate synthase activity | GO:0004049 | Molecular Function | 0.0 | 78% |
Blast2go | 4-amino-4-deoxychorismate synthase activity | GO:0046820 | Molecular Function | 0.0 | 78% |
Blast2go | chloroplast | GO:0009507 | Cellular Component | 0.0 | 78% |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | NUDIX hydrolase, NudL, conserved site | IPR000059 | - | 0.0 | - |
Sma3 | NUDIX hydrolase domain | IPR000086 | - | 0.0 | - |
Sma3 | IPR000991 | - | 0.0 | - | |
Sma3 | IPR001317 | - | 0.0 | - | |
Sma3 | Ribonuclease A | IPR001427 | - | 0.0 | - |
Sma3 | Phosphotransferase system, HPr serine phosphorylation site | IPR002114 | - | 0.0 | - |
Sma3 | ADC synthase | IPR005801 | - | 0.0 | - |
Sma3 | Para-aminobenzoate synthase, component I | IPR005802 | - | 0.0 | - |
Sma3 | IPR006220 | - | 0.0 | - | |
Sma3 | Anthranilate synthase, glutamine amidotransferase | IPR006221 | - | 0.0 | - |
Sma3 | Anthranilate synthase component I, N-terminal | IPR006805 | - | 0.0 | - |
Sma3 | Tyrosine-protein kinase, active site | IPR008266 | - | 0.0 | - |
Sma3 | IPR011702 | - | 0.0 | - | |
Sma3 | Chorismate binding, C-terminal | IPR015890 | - | 0.0 | - |
Sma3 | Aldehyde dehydrogenase, conserved site | IPR016160 | - | 0.0 | - |
Sma3 | Glutamine amidotransferase type 1 | IPR017926 | - | 0.0 | - |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: P32069
Fln msg: Unexpected stop codon in the beginning of your sequence, Unexpected STOP codon at 3' end. Distance to subject end: 109 aas, your sequence is shorter than subject: 48 - 621
Fln protein:
G
Protein Length:
49
Fln nts:
G
Fln Alignment:
biogeco2_mira_c8682___RNDLGRVCEPGTVHVPNLMDVESYATVHTLVSTIRG
P32069__________________RNDVGKVSKPGSVEVKKLKDIEWFSHVMHISSTVVG
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain