SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: biogeco2 v2.0

UniGene Name: biog2_v2.0_unigene11935

Length: 338 nt

This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense

UniGene Fasta (sense)

>biog2_v2.0_unigene11935
AGCAGGAACTTTTGTCTGCTGCCCAGATTCGAGAACTCGCATTCGGGCTCTAAGGTAGCGGGAAATCCTTCATCTGGGCCTTGCATACTACGCCGGAGACTGCAAACAGAGGAGCTCCTCGCAGTCTCTGCTCCTGGAAGGATTGAAGGATTTGAACGCGACAGCTACGGGCGAGGTATTGTATTGAGAAGATGGGCACCGTAGCTGCTCATCCTGTCTCATCCTACCAGGGGCGCTTTCATCAGCCATGAGCAGAGGACGATCACTTTCATTAGGCAGTGACAACCCAACAGCGTCATAGCGAGACGCAGATGAACACTTAATGAACACTTCCCCAT

Ace file of the UniGene biog2_v2.0_unigene11935 (antisense)

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Parent Assembly	Parent UniGene	Reads (related/total)
SustainPine v2.0	sp_v2.0_unigene5019	2/2

Source	Descriptions	Term	Type	e value	Identity
AutoFact	UDP-glycosyltransferase 73B4 [Arabidopsis thaliana] sp\|Q7Y232.1\|U73B4_ARATH RecName: Full=UDP-glycosyltransferase 73B4; AltName: Full=Flavonol 3-O-glucosyltransferase UGT73B4 gb\|AAP37678.1\| At2g15490 [Arabidopsis thaliana] dbj\|BAE99671.1\| putative glucosy	-	-	8.0e-08	45%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	51%
Blast2go	udp-glycosyltransferase 88a1-like	-	-	1.29299e-11	65%

Source	ECs	Term	Type	e value	Identity
Blast2go	Transferases, Glycosyltransferases, Hexosyltransferases.	EC:2.4.1.-	-	1.29299e-11	65%

Source	KEGGs	Term	e value	Identity
Blast2go	Fructose and mannose metabolism	00051	1.29299e-11	65%
Blast2go	N-Glycan biosynthesis	00510	1.29299e-11	65%
Blast2go	Mucin type O-Glycan biosynthesis	00512	1.29299e-11	65%
Blast2go	Various types of N-glycan biosynthesis	00513	1.29299e-11	65%
Blast2go	Other types of O-glycan biosynthesis	00514	1.29299e-11	65%
Blast2go	Biosynthesis of 12-, 14- and 16-membered macrolides	00522	1.29299e-11	65%
Blast2go	Glycosaminoglycan biosynthesis - keratan sulfate	00533	1.29299e-11	65%
Blast2go	Lipopolysaccharide biosynthesis	00540	1.29299e-11	65%
Blast2go	Peptidoglycan biosynthesis	00550	1.29299e-11	65%
Blast2go	Glycerolipid metabolism	00561	1.29299e-11	65%
Blast2go	Glycosylphosphatidylinositol(GPI)-anchor biosynthesis	00563	1.29299e-11	65%
Blast2go	Sphingolipid metabolism	00600	1.29299e-11	65%
Blast2go	Glycosphingolipid biosynthesis - lacto and neolacto series	00601	1.29299e-11	65%
Blast2go	Glycosphingolipid biosynthesis - globo series	00603	1.29299e-11	65%
Blast2go	Glycosphingolipid biosynthesis - ganglio series	00604	1.29299e-11	65%
Blast2go	Carotenoid biosynthesis	00906	1.29299e-11	65%
Blast2go	Zeatin biosynthesis	00908	1.29299e-11	65%
Blast2go	Flavonoid biosynthesis	00941	1.29299e-11	65%
Blast2go	Anthocyanin biosynthesis	00942	1.29299e-11	65%
Blast2go	Flavone and flavonol biosynthesis	00944	1.29299e-11	65%
Blast2go	Stilbenoid, diarylheptanoid and gingerol biosynthesis	00945	1.29299e-11	65%
Blast2go	Betalain biosynthesis	00965	1.29299e-11	65%
Blast2go	Biosynthesis of type II polyketide products	01057	1.29299e-11	65%
Blast2go	Metabolic pathways	01100	1.29299e-11	65%
Blast2go	Biosynthesis of secondary metabolites	01110	1.29299e-11	65%

Source	GOs	Term	Type	e value	Identity
Blast2go	transferase activity, transferring hexosyl groups	GO:0016758	Molecular Function	1.29299e-11	65%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: B8LPJ2

Fln msg: Overlapping hits, possible frame ERROR between 101 and 97, Unexpected STOP codon at 3' end. Distance to subject end: 88 aas, your sequence is shorter than subject: 68 - 498

Fln protein: QELLSAAQIRELAFGL*GSGKSFIWALHTTPxxxQTEELLAVSAPGRIEGFERDSYGRGIVLRRWAP*

Protein Length: 69

Fln nts: AGCAGGAACTTTTGTCTGCTGCCCAGATTCGAGAACTCGCATTCGGGCTCTAAGGTAGCGGGAAATCCTTCATCTGGGCCTTGCATACTACGCCGxxxxxxxxxCAAACAGAGGAGCTCCTCGCAGTCTCTGCTCCTGGAAGGATTGAAGGATTTGAACGCGACAGCTACGGGCGAGGTATTGTATTGAGAAGATGGGCACCGTAGCTGCTCATCCTGTCTCATCCTACCAGGGGCGCTTTCATCAGCCATGAGCAGAGGACGATCACTTTCATTAGGCAGTGACAACCCAACAGCGTCATAGCGAGACGCAGATGAACACTTAATGAACACTTCCCCAT

Fln Alignment:

biogeco2_mira_c8599___QELLSAAQIRELAFGL*GSGKSFIWALHTxxxxEELLAVSAPGRIEGFERDSYGRGIVLRRWAP*LLILSHPTRGAFISH
B8LPJ2__________________QFILNDKQICALATGLEGSGQAFVWAI-TxxxxEPKPTATEVGLPKGFEERTRDRGLIIWGWAPQLLILSHPSIGAFLSH

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain