|
||||||
|
UniGene Name: biog2_v2.0_unigene11906
Length: 144 nt
 UniGene Fasta
|
|---|
| >biog2_v2.0_unigene11906
T |
|
Ace file of the UniGene biog2_v2.0_unigene11906
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Parent Assembly | Parent UniGene | Reads (related/total) |
|---|---|---|
| SustainPine v2.0 | sp_v2.0_unigene4975 | 2/2 |
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | putative methyltransferase PMT21 [Arabidopsis thaliana] ref|NP_849408.1| putative methyltransferase PMT21 [Arabidopsis thaliana] sp|Q94II3.1|PMTL_ARATH RecName: Full=Probable methyltransferase PMT21; AltName: Full=Protein EARLY-RESPONSIVE TO DEHYDRATION 3 | - | - | 0.0 | 71% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 75% |
| Blast2go | methyltransferase pmt20 | - | - | 0.0 | 84% |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Transferases, Transferring one-carbon groups, Methyltransferases. | EC:2.1.1.- | - | 0.0 | 84% |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | phosphorylation | GO:0016310 | Biological Process | 0.0 | 84% |
| Blast2go | methylation | GO:0032259 | Biological Process | 0.0 | 84% |
| Blast2go | kinase activity | GO:0016301 | Molecular Function | 0.0 | 84% |
| Blast2go | methyltransferase activity | GO:0008168 | Molecular Function | 0.0 | 84% |
| Blast2go | Golgi apparatus | GO:0005794 | Cellular Component | 0.0 | 84% |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glycoside hydrolase, family 10 | IPR001000 | - | 0.0 | - |
| Sma3 | Zinc finger, RING-type | IPR001841 | - | 0.0 | - |
| Sma3 | Zinc finger, PHD-type | IPR001965 | - | 0.0 | - |
| Sma3 | Ankyrin repeat | IPR002110 | - | 0.0 | - |
| Sma3 | Putative S-adenosyl-L-methionine-dependent methyltransferase | IPR004159 | - | 0.0 | - |
| Sma3 | IPR017909 | - | 0.0 | - | |
| Sma3 | Chaperonin Cpn60, conserved site | IPR018370 | - | 0.0 | - |
| Sma3 | Zinc finger, C3HC4 RING-type | IPR018957 | - | 0.0 | - |
| Full-Lengther Next Prediction |
|---|
Fln status: Putative C-terminus
Fln database: coniferopsida.fasta
Fln subject: B8LRH0
Fln msg: STOP codon was not found. Distance to subject end: 1 aas, your sequence is shorter than subject: 47 - 72
Fln protein:
F
Protein Length:
48
Fln nts:
T
Fln Alignment:
biogeco2_mira_c8559___FVNSVKNLATGMRWNCHQRDTEDANSGDEKLLICQKR
B8LRH0__________________FVNSVYNLASGMRWNCHKRDTKDAKNDEEKLLICQKK
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
