|
||||||
|
UniGene Name: biog2_v2.0_unigene11777
Length: 194 nt
 UniGene Fasta
|
|---|
| >biog2_v2.0_unigene11777
G |
|
Ace file of the UniGene biog2_v2.0_unigene11777
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Parent Assembly | Parent UniGene | Reads (related/total) |
|---|---|---|
| SustainPine v2.0 | sp_v2.0_unigene1786 | 2/2 |
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | alanine aminotransferase [Oryza sativa Indica Group] | - | - | 0.0 | 80% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 62% |
| Blast2go | alanine-2-oxoglutarate aminotransferase 2 | - | - | 0.0 | 90% |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Alanine--glyoxylate transaminase. | EC:2.6.1.44 | - | 0.0 | 90% |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Alanine, aspartate and glutamate metabolism | 00250 | 0.0 | 90% | |
| Blast2go | Glycine, serine and threonine metabolism | 00260 | 0.0 | 90% | |
| Blast2go | Metabolic pathways | 01100 | 0.0 | 90% | |
| Blast2go | Gamma-glutamyltransferase. | EC:2.3.2.2 | - | 0.0 | 90% |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Cyanoamino acid metabolism | 00460 | 0.0 | 90% | |
| Blast2go | Glutathione metabolism | 00480 | 0.0 | 90% | |
| Blast2go | Arachidonic acid metabolism | 00590 | 0.0 | 90% | |
| Blast2go | Metabolic pathways | 01100 | 0.0 | 90% | |
| Blast2go | 1-aminocyclopropane-1-carboxylate synthase. | EC:4.4.1.14 | - | 0.0 | 90% |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Cysteine and methionine metabolism | 00270 | 0.0 | 90% | |
| Blast2go | Biosynthesis of plant hormones | 01070 | 0.0 | 90% | |
| Blast2go | Metabolic pathways | 01100 | 0.0 | 90% | |
| Blast2go | Biosynthesis of secondary metabolites | 01110 | 0.0 | 90% | |
| Blast2go | Alanine transaminase. | EC:2.6.1.2 | - | 0.0 | 90% |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Alanine, aspartate and glutamate metabolism | 00250 | 0.0 | 90% | |
| Blast2go | Carbon fixation in photosynthetic organisms | 00710 | 0.0 | 90% | |
| Blast2go | Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid | 01064 | 0.0 | 90% | |
| Blast2go | Metabolic pathways | 01100 | 0.0 | 90% | |
| Blast2go | Glutathione gamma-glutamylcysteinyltransferase. | EC:2.3.2.15 | - | 0.0 | 90% |
| Blast2go | Glycine transaminase. | EC:2.6.1.4 | - | 0.0 | 90% |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Glycine, serine and threonine metabolism | 00260 | 0.0 | 90% | |
| Blast2go | Metabolic pathways | 01100 | 0.0 | 90% |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | response to oxidative stress | GO:0006979 | Biological Process | 0.0 | 90% |
| Blast2go | 1-aminocyclopropane-1-carboxylate biosynthetic process | GO:0042218 | Biological Process | 0.0 | 90% |
| Blast2go | glutathione catabolic process | GO:0006751 | Biological Process | 0.0 | 90% |
| Blast2go | photorespiration | GO:0009853 | Biological Process | 0.0 | 90% |
| Blast2go | alanine-glyoxylate transaminase activity | GO:0008453 | Molecular Function | 0.0 | 90% |
| Blast2go | gamma-glutamyltransferase activity | GO:0003840 | Molecular Function | 0.0 | 90% |
| Blast2go | 1-aminocyclopropane-1-carboxylate synthase activity | GO:0016847 | Molecular Function | 0.0 | 90% |
| Blast2go | L-alanine:2-oxoglutarate aminotransferase activity | GO:0004021 | Molecular Function | 0.0 | 90% |
| Blast2go | glutathione gamma-glutamylcysteinyltransferase activity | GO:0016756 | Molecular Function | 0.0 | 90% |
| Blast2go | pyridoxal phosphate binding | GO:0030170 | Molecular Function | 0.0 | 90% |
| Blast2go | glycine:2-oxoglutarate aminotransferase activity | GO:0047958 | Molecular Function | 0.0 | 90% |
| Blast2go | peroxisome | GO:0005777 | Cellular Component | 0.0 | 90% |
| Blast2go | plant-type cell wall | GO:0009505 | Cellular Component | 0.0 | 90% |
| Blast2go | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | 90% |
| Blast2go | vacuole | GO:0005773 | Cellular Component | 0.0 | 90% |
| Blast2go | membrane | GO:0016020 | Cellular Component | 0.0 | 90% |
| Blast2go | apoplast | GO:0048046 | Cellular Component | 0.0 | 90% |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | 1-aminocyclopropane-1-carboxylate synthase | IPR001176 | - | 0.0 | - |
| Sma3 | Aminotransferase, class I/classII | IPR004839 | - | 0.0 | - |
| Sma3 | Pyridoxal phosphate-dependent transferase, major region, subdomain 1 | IPR015421 | - | 0.0 | - |
| Sma3 | Pyridoxal phosphate-dependent transferase, major region, subdomain 2 | IPR015422 | - | 0.0 | - |
| Full-Lengther Next Prediction |
|---|
Fln status: Putative Complete
Fln database: coniferopsida.fasta
Fln subject: B8LP40
Fln msg: STOP codon was not found. Distance to subject end: 8 aas, atg_distance in limit (1-15): atg_distance = 5, W2: There is no M at the beginning,
Fln protein:
L
Protein Length:
65
Fln nts:
G
Fln Alignment:
biogeco2_mira_c8395___LAVAEQCSIPGYREI-LFTRS-EVFPSFSTNSWTPLSASS-VSSQQ*RISEAKLFIRRKRNR
B8LP40__________________VAVAEQCSLSGYREIPVHTKANKVFSSVSTNSWTLFSAASFISSLLRRISEAKLSDRR-RNR
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
