SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: biogeco2 v2.0

UniGene Name: biog2_v2.0_unigene11226

Length: 347 nt

UniGene Fasta

>biog2_v2.0_unigene11226
ATGGGGATCATAAATTTCGTGTTAGCTCAAGAAAACGCCAAGAAAGCGAATCAATTAACAGGAAACACTCGTTTACTCAAATGAATAAGACTCTGTCATAACCGAGGTGTTGAGGAACCAGGGAGTGTCGCAGGTATCGAATTTGGGACCAAGAATGGCCTCCAAACTCTGTCCAGCATCTCCTGCTCTGGGTTTCTGTAACTTCTCATTGCCGCCTAAATCGCGTCAATTAACCGAAACAGCATTTCCCAAGCCCGCCACGAAGGCATGGAGAAATTCGGCATCAGTTCATCAATCAAGAGCCGAAAGGCGAATTCCCCGTGTGATGTCATCGGCCCAATCCGCGA

Ace file of the UniGene biog2_v2.0_unigene11226

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Parent Assembly	Parent UniGene	Reads (related/total)
SustainPine v2.0	sp_v2.0_unigene9858	2/2

Source	Descriptions	Term	Type	Identity
AutoFact	prephenate dehydratase [Ipomoea trifida] dbj\|BAF37790.1\| hypothetical protein [Ipomoea trifida]	-	-	66%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	77%
Blast2go	protein	-	-	86%

Source	ECs	Term	Type	e value	Identity
Blast2go	Arogenate dehydratase.	EC:4.2.1.91	-	0.0	86%

Source	KEGGs	Term	Type	Identity
Blast2go	Phenylalanine, tyrosine and tryptophan biosynthesis	00400		86%
Blast2go	Biosynthesis of phenylpropanoids	01061		86%
Blast2go	Biosynthesis of alkaloids derived from shikimate pathway	01063		86%
Blast2go	Biosynthesis of plant hormones	01070		86%
Blast2go	Metabolic pathways	01100		86%
Blast2go	Biosynthesis of secondary metabolites	01110		86%
Blast2go	Transferases, Transferring one-carbon groups, Methyltransferases.	EC:2.1.1.-	-	86%

Source	KEGGs	Term	Type	Identity
Blast2go	Ubiquinone and other terpenoid-quinone biosynthesis	00130		86%
Blast2go	Tetracycline biosynthesis	00253		86%
Blast2go	Histidine metabolism	00340		86%
Blast2go	Tyrosine metabolism	00350		86%
Blast2go	Phenylalanine metabolism	00360		86%
Blast2go	Tryptophan metabolism	00380		86%
Blast2go	Benzoxazinoid biosynthesis	00402		86%
Blast2go	Selenocompound metabolism	00450		86%
Blast2go	Biosynthesis of 12-, 14- and 16-membered macrolides	00522		86%
Blast2go	Polycyclic aromatic hydrocarbon degradation	00624		86%
Blast2go	Methane metabolism	00680		86%
Blast2go	Porphyrin and chlorophyll metabolism	00860		86%
Blast2go	Carotenoid biosynthesis	00906		86%
Blast2go	Phenylpropanoid biosynthesis	00940		86%
Blast2go	Flavonoid biosynthesis	00941		86%
Blast2go	Anthocyanin biosynthesis	00942		86%
Blast2go	Stilbenoid, diarylheptanoid and gingerol biosynthesis	00945		86%
Blast2go	Isoquinoline alkaloid biosynthesis	00950		86%
Blast2go	Insect hormone biosynthesis	00981		86%
Blast2go	Biosynthesis of type II polyketide products	01057		86%
Blast2go	Biosynthesis of alkaloids derived from shikimate pathway	01063		86%
Blast2go	Metabolic pathways	01100		86%
Blast2go	Biosynthesis of secondary metabolites	01110		86%
Blast2go	Prephenate dehydratase.	EC:4.2.1.51	-	86%

Source	KEGGs	Term	Identity
Blast2go	Phenylalanine, tyrosine and tryptophan biosynthesis	00400	86%
Blast2go	Biosynthesis of phenylpropanoids	01061	86%
Blast2go	Biosynthesis of alkaloids derived from shikimate pathway	01063	86%
Blast2go	Metabolic pathways	01100	86%
Blast2go	Biosynthesis of secondary metabolites	01110	86%

Source	GOs	Term	Type	Identity
Blast2go	methylation	GO:0032259	Biological Process	86%
Blast2go	L-phenylalanine biosynthetic process	GO:0009094	Biological Process	86%
Blast2go	arogenate dehydratase activity	GO:0047769	Molecular Function	86%
Blast2go	RNA binding	GO:0003723	Molecular Function	86%
Blast2go	amino acid binding	GO:0016597	Molecular Function	86%
Blast2go	methyltransferase activity	GO:0008168	Molecular Function	86%
Blast2go	prephenate dehydratase activity	GO:0004664	Molecular Function	86%

Source	InterPros	Term	Type	Identity
Sma3	Amino acid-binding ACT	IPR002912	-	-
Sma3	Prephenate dehydratase	IPR001086	-	-
Sma3	Prephenate dehydratase, conserved site	IPR018528	-	-

Full-Lengther Next Prediction

Fln status: N-terminus

Fln database: coniferopsida.fasta

Fln subject: B8LQ85

Fln msg: Distance to subject end: 335 aas, your sequence is shorter than subject: 64 - 402

Fln protein: MASKLCPASPALGFCNFSLPPKSRQLTETAFPKPATKAWRNSASVHQSRAERRIPRVMSSAQSA

Protein Length: 65

Fln nts: ATGGGGATCATAAATTTCGTGTTAGCTCAAGAAAACGCCAAGAAAGCGAATCAATTAACAGGAAACACTCGTTTACTCAAATGAATAAGACTCTGTCATAACCGAGGTGTTGAGGAACCAGGGAGTGTCGCAGGTATCGAATTTGGGACCAAGA_-_ATGGCCTCCAAACTCTGTCCAGCATCTCCTGCTCTGGGTTTCTGTAACTTCTCATTGCCGCCTAAATCGCGTCAATTAACCGAAACAGCATTTCCCAAGCCCGCCACGAAGGCATGGAGAAATTCGGCATCAGTTCATCAATCAAGAGCCGAAAGGCGAATTCCCCGTGTGATGTCATCGGCCCAATCCGCGA

Fln Alignment:

biogeco2_mira_c7738___MASKLCPASPALGFCNFSLPPKSRQLTETAFPKPATKAWRN---SASVHQSRAERRIPRVMSSAQSA
B8LQ85__________________MASKLCPSSPALGFSNSLLLPKSRQSTETAFPKPTTKLWRNSARSASLHQSGAEWRIPRAMSSAQSA

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain