UniGene Name: biog2_v2.0_unigene11096
Length: 245 nt
UniGene Fasta |
---|
>biog2_v2.0_unigene11096
T |
Ace file of the UniGene biog2_v2.0_unigene11096 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Parent Assembly | Parent UniGene | Reads (related/total) |
---|---|---|
SustainPine v2.0 | sp_v2.0_unigene792 | 2/2 |
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Lethal leaf spot 1-like protein n=1 Tax=Solanum lycopersicum RepID=Q8W5A3_SOLLC | - | - | 0.0 | 73% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 100% |
Blast2go | pheophorbide a oxygenase | - | - | 0.0 | 86% |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | 1-aminocyclopropane-1-carboxylate deaminase. | EC:3.5.99.7 | - | 0.0 | 86% |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | Propanoate metabolism | 00640 | 0.0 | 86% | |
Blast2go | Chlorophyllide-a oxygenase. | EC:1.13.12.14 | - | 0.0 | 86% |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | Porphyrin and chlorophyll metabolism | 00860 | 0.0 | 86% | |
Blast2go | Metabolic pathways | 01100 | 0.0 | 86% | |
Blast2go | Biosynthesis of secondary metabolites | 01110 | 0.0 | 86% | |
Blast2go | Protochlorophyllide reductase. | EC:1.3.1.33 | - | 0.0 | 86% |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | Porphyrin and chlorophyll metabolism | 00860 | 0.0 | 86% | |
Blast2go | Metabolic pathways | 01100 | 0.0 | 86% | |
Blast2go | Biosynthesis of secondary metabolites | 01110 | 0.0 | 86% | |
Blast2go | D-cysteine desulfhydrase. | EC:4.4.1.15 | - | 0.0 | 86% |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | Cysteine and methionine metabolism | 00270 | 0.0 | 86% |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | 86% |
Blast2go | ethylene biosynthetic process | GO:0009693 | Biological Process | 0.0 | 86% |
Blast2go | cell death | GO:0008219 | Biological Process | 0.0 | 86% |
Blast2go | fruit development | GO:0010154 | Biological Process | 0.0 | 86% |
Blast2go | flower development | GO:0009908 | Biological Process | 0.0 | 86% |
Blast2go | chlorophyll catabolic process | GO:0015996 | Biological Process | 0.0 | 86% |
Blast2go | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | 86% |
Blast2go | defense response to bacterium, incompatible interaction | GO:0009816 | Biological Process | 0.0 | 86% |
Blast2go | 1-aminocyclopropane-1-carboxylate deaminase activity | GO:0008660 | Molecular Function | 0.0 | 86% |
Blast2go | 2 iron, 2 sulfur cluster binding | GO:0051537 | Molecular Function | 0.0 | 86% |
Blast2go | cobalt ion binding | GO:0050897 | Molecular Function | 0.0 | 86% |
Blast2go | chlorophyllide a oxygenase [overall] activity | GO:0010277 | Molecular Function | 0.0 | 86% |
Blast2go | protochlorophyllide reductase activity | GO:0016630 | Molecular Function | 0.0 | 86% |
Blast2go | D-cysteine desulfhydrase activity | GO:0019148 | Molecular Function | 0.0 | 86% |
Blast2go | pheophorbide a oxygenase activity | GO:0032441 | Molecular Function | 0.0 | 86% |
Blast2go | mitochondrion | GO:0005739 | Cellular Component | 0.0 | 86% |
Blast2go | chloroplast inner membrane | GO:0009706 | Cellular Component | 0.0 | 86% |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | IPR005806 | - | 0.0 | - | |
Sma3 | Pheophorbide a oxygenase | IPR013626 | - | 0.0 | - |
Sma3 | Rieske [2Fe-2S] iron-sulphur domain | IPR017941 | - | 0.0 | - |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: C0PTJ3
Fln msg: ERROR#3, very serious frame error, Overlapping hits, possible frame ERROR between 80 and 80, Distance to subject end: 141 aas, your sequence is shorter than subject: 81 - 544
Fln protein:
L
Protein Length:
82
Fln nts:
T
Fln Alignment:
biogeco2_mira_c7584___LGEQTWEIWICSFNTPMLPGKTRSIVCSARNFFRFTMPGPAWWQLVPRWHEHWTSNLVYDGDMIVLQGQEKISL
C0PTJ3__________________LGEQTWEIWICSFNTPMLPGKTRSIVCSARNFFRFTMPGPAWWQLVPRWHEHWTSNKVYDGDMIVLQGQEKTFL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain