UniGene Name: biog2_v2.0_unigene9511
Length: 229 nt
UniGene Fasta |
---|
>biog2_v2.0_unigene9511
A |
Ace file of the UniGene biog2_v2.0_unigene9511 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Parent Assembly | Parent UniGene | Reads (related/total) |
---|---|---|
SustainPine v2.0 | sp_v2.0_unigene28231 | 3/3 |
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | MAC/Perforin domain-containing protein [Arabidopsis thaliana] gb|AAG51760.1|AC068667_39 unknown protein; 124288-121737 [Arabidopsis thaliana] gb|AAL75908.1| At1g29690/F15D2_24 [Arabidopsis thaliana] gb|ABO38750.1| At1g29690 [Arabidopsis thaliana] gb|AEE31 | - | - | 0.0 | 68% |
FL-Next | tr=Putative uncharacterized protein; Vitis vinifera (Grape). | - | - | 0.0 | 61% |
Blast2go | protein | - | - | 0.0 | 80% |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | Arsenite-transporting ATPase. | EC:3.6.3.16 | - | 0.0 | 80% |
Blast2go | Cinnamyl-alcohol dehydrogenase. | EC:1.1.1.195 | - | 0.0 | 80% |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | Phenylpropanoid biosynthesis | 00940 | 0.0 | 80% | |
Blast2go | Biosynthesis of phenylpropanoids | 01061 | 0.0 | 80% | |
Blast2go | Metabolic pathways | 01100 | 0.0 | 80% | |
Blast2go | Biosynthesis of secondary metabolites | 01110 | 0.0 | 80% | |
Blast2go | Glutathione gamma-glutamylcysteinyltransferase. | EC:2.3.2.15 | - | 0.0 | 80% |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | arsenite transport | GO:0015700 | Biological Process | 0.0 | 80% |
Blast2go | indole glucosinolate catabolic process | GO:0042344 | Biological Process | 0.0 | 80% |
Blast2go | immune response | GO:0006955 | Biological Process | 0.0 | 80% |
Blast2go | phytochelatin biosynthetic process | GO:0046938 | Biological Process | 0.0 | 80% |
Blast2go | defense response by callose deposition in cell wall | GO:0052544 | Biological Process | 0.0 | 80% |
Blast2go | lignin biosynthetic process | GO:0009809 | Biological Process | 0.0 | 80% |
Blast2go | response to arsenic-containing substance | GO:0046685 | Biological Process | 0.0 | 80% |
Blast2go | defense response to bacterium | GO:0042742 | Biological Process | 0.0 | 80% |
Blast2go | cell death | GO:0008219 | Biological Process | 0.0 | 80% |
Blast2go | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | 80% |
Blast2go | protein binding | GO:0005515 | Molecular Function | 0.0 | 80% |
Blast2go | cadmium ion binding | GO:0046870 | Molecular Function | 0.0 | 80% |
Blast2go | arsenite-transmembrane transporting ATPase activity | GO:0015446 | Molecular Function | 0.0 | 80% |
Blast2go | copper ion binding | GO:0005507 | Molecular Function | 0.0 | 80% |
Blast2go | cinnamyl-alcohol dehydrogenase activity | GO:0045551 | Molecular Function | 0.0 | 80% |
Blast2go | glutathione gamma-glutamylcysteinyltransferase activity | GO:0016756 | Molecular Function | 0.0 | 80% |
Blast2go | cytosol | GO:0005829 | Cellular Component | 0.0 | 80% |
Blast2go | phytochelatin transmembrane transporter activity | GO:0071992 | Biological Process | 0.0 | 80% |
Blast2go | phytochelatin transmembrane transport | GO:0071994 | Biological Process | 0.0 | 80% |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Oligopeptide transporter | IPR000109 | - | 0.0 | - |
Sma3 | Membrane attack complex component/perforin/complement C9 | IPR001862 | - | 0.0 | - |
Full-Lengther Next Prediction |
---|
Fln status: Putative C-terminus
Fln database: tr_plants
Fln subject: A5C8U6
Fln msg: STOP codon was not found. Distance to subject end: 6 aas, your sequence is shorter than subject: 75 - 382
Fln protein:
G
Protein Length:
76
Fln nts:
A
Fln Alignment:
biogeco2_mira_c5132___HTPVSHQKVGMHTSNQSALKISGNPSSGSTVQIG-KLAKFVDVTEMTKGPQDMPGHWLVTGAKLGVEKGRIVLRV
A5C8U6_________________HAPNDKLKKGITTGS---IVNNGDSSSGSRENTGNKLAKFVDMSEMTKGPQDPPGHWLVTGGKLGVEKGKIVLRV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain