UniGene Name: hypoth_v1_unigene37616
Length: 96 nt
UniGene Fasta |
---|
>hypoth_v1_unigene37616
A |
Ace file of the UniGene hypoth_v1_unigene37616 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Parent Assembly | Parent UniGene | Reads (related/total) |
---|---|---|
Solea senegalensis v2.0 (global assembly) | solea_v2.0_unigene98223 | 2/2 |
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
FL-Next | tr=Uncharacterized protein; Danio rerio (Zebrafish) (Brachydanio rerio). | - | - | 0.0 | 80% |
Sma3 | Acetyl-CoA carboxylase alpha | - | - | 1.721e-08 | - |
AutoFact | acetyl-CoA carboxylase 1-like; K11262 acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14] | - | - | 4.0e-09 | 87% |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | acetyl-CoA carboxylase | EC:6.4.1.2 | - | 2.868e-08 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Fatty acid biosynthesis | 00061 | 2.868e-08 | % | |
Sma3 | Tetracycline biosynthesis | 00253 | 2.868e-08 | % | |
Sma3 | Pyruvate metabolism | 00620 | 2.868e-08 | % | |
Sma3 | Propanoate metabolism | 00640 | 2.868e-08 | % | |
Sma3 | Carbon fixation pathways in prokaryotes | 00720 | 2.868e-08 | % | |
Sma3 | Metabolic pathways | 01100 | 2.868e-08 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 2.868e-08 | % | |
Sma3 | Microbial metabolism in diverse environments | 01120 | 2.868e-08 | % | |
Sma3 | Aflatoxin biosynthesis | 00254 | 2.868e-08 | % |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
FL-2 | acetyl-CoA carboxylase | EC:6.4.1.2 | - | 4.0e-09 | 87% |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
FL-2 | Fatty acid biosynthesis | 00061 | 4.0e-09 | 87% | |
FL-2 | Tetracycline biosynthesis | 00253 | 4.0e-09 | 87% | |
FL-2 | Pyruvate metabolism | 00620 | 4.0e-09 | 87% | |
FL-2 | Propanoate metabolism | 00640 | 4.0e-09 | 87% | |
FL-2 | Carbon fixation pathways in prokaryotes | 00720 | 4.0e-09 | 87% | |
FL-2 | Metabolic pathways | 01100 | 4.0e-09 | 87% | |
FL-2 | Biosynthesis of secondary metabolites | 01110 | 4.0e-09 | 87% | |
FL-2 | Microbial metabolism in diverse environments | 01120 | 4.0e-09 | 87% | |
FL-2 | Aflatoxin biosynthesis | 00254 | 4.0e-09 | 87% | |
FL-2 | biotin carboxylase | EC:6.3.4.14 | - | 4.0e-09 | 87% |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
FL-2 | Fatty acid biosynthesis | 00061 | 4.0e-09 | 87% | |
FL-2 | Metabolic pathways | 01100 | 4.0e-09 | 87% |
Source | Gene names |
---|---|
Sma3 | ACACA; ACACB; acaca; acacb; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | acetyl-CoA carboxylase activity | GO:0003989 | Molecular Function | 0.0 | - |
Sma3 | biotin carboxylase activity | GO:0004075 | Molecular Function | 6.124e-38 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 4.996e-10 | - |
Sma3 | fatty acid biosynthetic process | GO:0006633 | Biological Process | 1.078e-31 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Carboxyl transferase | IPR000022 | - | 9.31863e-43 | - |
Sma3 | Biotin/lipoyl attachment | IPR000089 | - | 1.957e-35 | - |
Sma3 | Biotin-binding site | IPR001882 | - | 3.177e-25 | - |
Sma3 | Carbamoyl-phosphate synthetase large subunit-like, ATP-binding domain | IPR005479 | - | 5.439e-36 | - |
Sma3 | Carbamoyl-phosphate synthase, large subunit, N-terminal | IPR005481 | - | 1.457e-36 | - |
Sma3 | Biotin carboxylase, C-terminal | IPR005482 | - | 4.107e-39 | - |
Sma3 | Single hybrid motif | IPR011053 | - | 6.249e-34 | - |
Sma3 | Rudiment single hybrid motif | IPR011054 | - | 1.833e-36 | - |
Sma3 | ATP-grasp fold | IPR011761 | - | 1.602e-33 | - |
Sma3 | Acetyl-coenzyme A carboxyltransferase, N-terminal | IPR011762 | - | 4.93257e-43 | - |
Sma3 | Acetyl-coenzyme A carboxyltransferase, C-terminal | IPR011763 | - | 6.12367e-43 | - |
Sma3 | Biotin carboxylation domain | IPR011764 | - | 2.805e-38 | - |
Sma3 | Acetyl-CoA carboxylase, central domain | IPR013537 | - | 0.0 | - |
Sma3 | ATP-grasp fold, subdomain 1 | IPR013815 | - | 1.852e-32 | - |
Sma3 | ATP-grasp fold, subdomain 2 | IPR013816 | - | 6.205e-30 | - |
Sma3 | IPR013817 | - | 1.708e-33 | - | |
Sma3 | Pre-ATP-grasp domain | IPR016185 | - | 3.197e-33 | - |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: actinopterygii.fasta
Fln subject: F1QH12
Fln msg: Distance to subject end: 120 aas, your sequence is shorter than subject: 32 - 2356
Fln protein:
M
Protein Length:
33
Fln nts:
A
Fln Alignment:
hypothalamus_mira_c27117___MQEKGVITDILDWKNVRTFFYWRLRRLLLEQ
F1QH12_________________MQEKGVITDILEWSTSRQFFYWRLRRLLLEE
Curation |
---|
No curations to show
|
IFAPA Centro El Toruño. Ctra. N. IV Km. 654a. Camino de Tiro Pichón. El Puerto de Santa María (Cádiz), Spain. |