SoleaDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: Hypothalamus v1

UniGene Name: hypoth_v1_unigene27054

Length: 191 nt

UniGene Fasta

>hypoth_v1_unigene27054
TGGGCACCAAAAGATCTCTGCCAGCTAAAATGTTGGAGGAAATCAGCCTGAATATCGCCAAGTTCAACATCCATGCTTTAGTGATCATCGGTGGATTTGAGGCTTATGTGGGAGGCCTGGAGCTGGTTCAGGCCAGAGAGAAATACGAGGAGATGTGCATTCCTATGGTGGTCATCCCTGCCACTGTCTCA

Ace file of the UniGene hypoth_v1_unigene27054

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Parent Assembly	Parent UniGene	Reads (related/total)
Solea senegalensis v2.0 (global assembly)	solea_v2.0_unigene25670	3/3

Source	Descriptions	Term	Type	e value	Identity
FL-Next	tr=Uncharacterized protein; Danio rerio (Zebrafish) (Brachydanio rerio).	-	-	0.0	90%
Sma3	Phosphohexokinase	-	-	0.0	-
AutoFact	pfkmb, MGC162168, im:7137110, wu:fc58g11; phosphofructokinase, muscle b; K00850 6-phosphofructokinase [EC:2.7.1.11]	-	-	6.0e-25	90%

Source	ECs	Term	Type	e value	Identity
Sma3	6-phosphofructokinase	EC:2.7.1.11	-	0.0	-

Source	KEGGs	Term	Identity
Sma3	Glycolysis / Gluconeogenesis	00010	%
Sma3	Pentose phosphate pathway	00030	%
Sma3	Fructose and mannose metabolism	00051	%
Sma3	Galactose metabolism	00052	%
Sma3	Methane metabolism	00680	%
Sma3	Biosynthesis of phenylpropanoids	01061	%
Sma3	Biosynthesis of terpenoids and steroids	01062	%
Sma3	Biosynthesis of alkaloids derived from shikimate pathway	01063	%
Sma3	Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid	01064	%
Sma3	Biosynthesis of alkaloids derived from histidine and purine	01065	%
Sma3	Biosynthesis of alkaloids derived from terpenoid and polyketide	01066	%
Sma3	Biosynthesis of plant hormones	01070	%
Sma3	Metabolic pathways	01100	%
Sma3	Biosynthesis of secondary metabolites	01110	%
Sma3	Microbial metabolism in diverse environments	01120	%

Source	ECs	Term	Type	e value	Identity
FL-2	6-phosphofructokinase	EC:2.7.1.11	-	6.0e-25	90%

Source	KEGGs	Term	e value	Identity
FL-2	Glycolysis / Gluconeogenesis	00010	6.0e-25	90%
FL-2	Pentose phosphate pathway	00030	6.0e-25	90%
FL-2	Fructose and mannose metabolism	00051	6.0e-25	90%
FL-2	Galactose metabolism	00052	6.0e-25	90%
FL-2	Methane metabolism	00680	6.0e-25	90%
FL-2	Biosynthesis of phenylpropanoids	01061	6.0e-25	90%
FL-2	Biosynthesis of terpenoids and steroids	01062	6.0e-25	90%
FL-2	Biosynthesis of alkaloids derived from shikimate pathway	01063	6.0e-25	90%
FL-2	Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid	01064	6.0e-25	90%
FL-2	Biosynthesis of alkaloids derived from histidine and purine	01065	6.0e-25	90%
FL-2	Biosynthesis of alkaloids derived from terpenoid and polyketide	01066	6.0e-25	90%
FL-2	Biosynthesis of plant hormones	01070	6.0e-25	90%
FL-2	Metabolic pathways	01100	6.0e-25	90%
FL-2	Biosynthesis of secondary metabolites	01110	6.0e-25	90%
FL-2	Microbial metabolism in diverse environments	01120	6.0e-25	90%

Source	Gene names
Sma3	PFKL; PFKM (2 of 2); PFKP; pfk; pfkm; pfkp;

Source	GOs	Term	Type	e value	Identity
Sma3	6-phosphofructokinase complex	GO:0005945	Cellular Component	0.0	-
Sma3	6-phosphofructokinase activity	GO:0003872	Molecular Function	0.0	-
Sma3	ATP binding	GO:0005524	Molecular Function	9.071e-20	-
Sma3	glycolytic process	GO:0006096	Biological Process	0.0	-

Source	InterPros	Term	Type	Identity
Sma3	Phosphofructokinase domain	IPR000023	-	-
Sma3	6-phosphofructokinase, eukaryotic type	IPR009161	-	-
Sma3	Phosphofructokinase, conserved site	IPR015912	-	-
Sma3	Phosphofructokinase	IPR022953	-	-

Full-Lengther Next Prediction

Fln status: Internal

Fln database: actinopterygii.fasta

Fln subject: F1R047

Fln msg: Distance to subject end: 247 aas, your sequence is shorter than subject: 63 - 776

Fln protein: GTKRSLPAKMLEEISLNIAKFNIHALVIIGGFEAYVGGLELVQAREKYEEMCIPMVVIPATVS

Protein Length: 64

Fln nts: TGGGCACCAAAAGATCTCTGCCAGCTAAAATGTTGGAGGAAATCAGCCTGAATATCGCCAAGTTCAACATCCATGCTTTAGTGATCATCGGTGGATTTGAGGCTTATGTGGGAGGCCTGGAGCTGGTTCAGGCCAGAGAGAAATACGAGGAGATGTGCATTCCTATGGTGGTCATCCCTGCCACTGTCTCA

Fln Alignment:

hypothalamus_mira_c12089___GTKRSLPAKMLEEISLNIAKFNIHALVIIGGFEAYVGGLELVQAREKYEEMCIPMVVIPATVS
F1R047_________________GTKRSLPANMIEEISLNIAKFNIHALVIIGGFEAFVGGLELVTAREKYEELCIPLVVIPATVS

Curation

No curations to show

Back