If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Fln status: C-terminus

Fln database: coniferopsida.fasta

Fln subject: C0PRH2

Fln msg: Separated hits, possible frame ERROR between 185 and 194, and overlapping frame ERROR between 376 and 376, Unexpected stop codon in the beginning of your sequence, your sequence is shorter than subject: 152 - 367

Test code: 0

Test Code was used to find complete genes when there was not found a reliable orthologue. The best ORF (Open Reading Frame) is shown, and only ORFs > 200pb were analyzed. Your ORF will be more reliable if a stop codon was found before the start codon. A Test Code value > 0.95 means the ORF is probably coding. A Test Code value < 0.74 means the ORF is probably non-coding. Test Code values in between 0.74 and 0.95 mean it is uncertain whether the ORF is coding or not.

Fln protein: S*PWLSLNVQSVLNPSIPFVAIVAGAKYDTKIGPLKQMYKKVDKLVLGGLIYNTYLCRDLxxxxGVEESDIELAKELVEQDKVHKKILELQVLVETDTLDGRFEGKFRTIDVKDFAPGQTYKYxxxVDPVSFERDEVKQAMNSAKLYLLML*

Protein Length: 153

Fln nts: CGTCGTGACCTTGGCTGTCACTCAATGTGCAATCTGTCTTGAATCCCAGCATACCATTTGTTGCAATTGTTGCTGGTGCAAAGTATGATACTAAGATTGGTCCATTAAAACAGATGTACAAGAAAGTTGATAAGTTGGTTCTGGGTGGTCTCATTTACAATACTTATCTATGTCGTGATCTTGGxxxxxxxxxCGGTGTTGAGGAATCAGATATTGAACTAGCAAAAGAGCTGGTAGAACAGGATAAGGTGCACAAAAAAATTCTTGAGTTGCAGGTTCTGGTTGAAACTGATACTCTGGATGGTAGATTTGAAGGGAAATTCAGAACGATTGATGTCAAGGACTTTGCTCCTGGCCAGACTTACAAGTATGTxxxxxxTGTTGATCCTGTTTCATTTGAGAGAGATGAGGTTAAACAAGCAATGAACTCAGCTAAGCTATATTTGTTAATGCTGTGACGGGACTTCGCAGTGAGTGACAGGCCACTGAG

Fln Alignment:

sp_v1.1_unigene81180___NVQSVLNPSIPFVAIVAGAKYDTKIGPLKQMYKKVDKLVLGGLIYNTYLCRDLGxxxGVEESDIELAKELVEQDKVHKKILELQVLVETDTLDGRFEGKFRTIDVKDFAPGQTYKYVVDVDPVSFERDEVKQAMNSAKLYLLML
C0PRH2_______________HVEAVLNPTRPFIAIVAGSKYDTKIGPLNQIYKKVDKLVLGGVIYNTYLCAKYGxxxGVQDSDIELAKELVEQDKTQGKIVEMDILVETDTLSGRFEGKYRAVNVKDFAPGKTYNYIVDIDPLSLESEDVLQALNSAKKYLSML