Fln status:
Internal
Fln database:
tr_plants
Fln subject:
B9SHY3
Fln msg:
Unexpected stop codon in the beginning of your sequence, Unexpected STOP codon at 3' end. Distance to subject end: 269 aas, your sequence is shorter than subject: 58 - 643
Test code:
0
Test Code was used to find complete genes when there was not found a reliable orthologue.
The best ORF (Open Reading Frame) is shown, and only ORFs > 200pb were analyzed.
Your ORF will be more reliable if a stop codon was found before the start codon.
A Test Code value > 0.95 means the ORF is probably coding.
A Test Code value < 0.74 means the ORF is probably non-coding.
Test Code values in between 0.74 and 0.95 mean it is uncertain whether the ORF is coding or not.
Fln protein:
RRDLGCHSS*LLYDTC*GFFYAYVPLTAKRMTGNCISRRVYSMSKWCLAYHKENFAL*
Protein Length:
59
Fln nts:
CGTCGTGACCTTGGCTGTCACTCAAGTTGATTACTTTACGATACATGCTAGGGGTTCTTCTACGCTTACGTACCTCTGACTGCAAAGCGAATGACTGGAAATTGTATCTCGAGGAGGGTCTACTCCATGTCAAAGTGGTGTTTGGCGTATCATAAAGAGAATTTTGCATTATGAGCATTGGGACGACATTACTTGACATTCTGTAAATC
Fln Alignment: