Fln status:
Putative C-terminus
Fln database:
coniferopsida.fasta
Fln subject:
A9NQ02
Fln msg:
ERROR#3, very serious frame error, Overlapping hits, possible frame ERROR between 80 and 80, STOP codon was not found. Distance to subject end: 11 aas, your sequence is shorter than subject: 66 - 154
Test code:
0
Test Code was used to find complete genes when there was not found a reliable orthologue.
The best ORF (Open Reading Frame) is shown, and only ORFs > 200pb were analyzed.
Your ORF will be more reliable if a stop codon was found before the start codon.
A Test Code value > 0.95 means the ORF is probably coding.
A Test Code value < 0.74 means the ORF is probably non-coding.
Test Code values in between 0.74 and 0.95 mean it is uncertain whether the ORF is coding or not.
Fln protein:
SCLGCHSDTDSEEELKEAFRVFGCDxxGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQI
Protein Length:
67
Fln nts:
CGTCGTGCCTTGGCTGTCACTCAGATACTGATTCTGAAGAGGAGCTGAAGGAAGCATTTCGTGTTTTTGGCTGTGATxxxxxxGGTTTTATCTCTGCTGCTGAGCTACGTCATGTCATGACAAACCTCGGAGAGAAGCTTACTGATGAGGAAGTGGATGAAATGATTCGGGAGGCTGATGTGGATGGAGATGGACAAATCAA
Fln Alignment:
UniGene Fasta
