If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Fln status: Internal

Fln database: sp_plants

Fln subject: Q08A71

Fln msg: Overlapping hits, possible frame ERROR between 74 and 74, Unexpected stop codon in the beginning of your sequence, Distance to subject end: 136 aas, your sequence is shorter than subject: 87 - 435

Test code: 0

Test Code was used to find complete genes when there was not found a reliable orthologue. The best ORF (Open Reading Frame) is shown, and only ORFs > 200pb were analyzed. Your ORF will be more reliable if a stop codon was found before the start codon. A Test Code value > 0.95 means the ORF is probably coding. A Test Code value < 0.74 means the ORF is probably non-coding. Test Code values in between 0.74 and 0.95 mean it is uncertain whether the ORF is coding or not.

Fln protein: S*PWLSLILPSHATLYMAPVTHPxxYSESIDFWRNVYGIDMSAMLPLAKQCAFEEPCIETITAENVLTWAIVIKQIDCSTVTIQELE

Protein Length: 88

Fln nts: CGTCGTGACCTTGGCTGTCACTCATTTTGCCTTCTCATGCGACATTGTACATGGCACCAGTTACACATCCTxxxxxxTACAGTGAAAGTATTGACTTCTGGCGAAATGTTTATGGAATTGATATGTCTGCGATGTTACCATTGGCAAAGCAATGTGCCTTTGAGGAGCCTTGCATTGAAACAATTACAGCAGAAAATGTCTTGACATGGGCAATTGTTATCAAACAAATTGATTGTAGCACTGTCACAATACAGGAGTTGGAA

Fln Alignment:

sp_v1.1_unigene70117___WLS---LILPSHATLYMAPVTHPERYSESIDFWRNVYGIDMSAMLPLAKQCAFEEPCIETITAENVLTWAIVIKQIDCSTVTIQELE
Q08A71_______________WLKPGGLILPSHATLYMAPISHPDRYSHSIDFWRNVYGIDMSAMMQLAKQCAFEEPSVESISGENVLTWPEVVKHIDCKTIKIQELD