Fln status:
Putative N-terminus
Fln database:
tr_plants
Fln subject:
A9SU25
Fln msg:
Distance to subject end: 101 aas, atg_distance in limit (1-15): atg_distance = 12, Unexpected STOP codon in 5 prime region, your sequence is shorter than subject: 72 - 190
Test code:
1
Test Code was used to find complete genes when there was not found a reliable orthologue.
The best ORF (Open Reading Frame) is shown, and only ORFs > 200pb were analyzed.
Your ORF will be more reliable if a stop codon was found before the start codon.
A Test Code value > 0.95 means the ORF is probably coding.
A Test Code value < 0.74 means the ORF is probably non-coding.
Test Code values in between 0.74 and 0.95 mean it is uncertain whether the ORF is coding or not.
Fln protein:
PWLSLKSYGDQKAGQAKEGIYNAKETAQEKGSQAVEQAQEALKRAKEAGQEKGSQTVEQAQEALKRAKDVAR
Protein Length:
73
Fln nts:
CGTCGTGACCTTGGCTGTCACTCAAGTCATATGGAGACCAGAAAGCAGGCCAAGCAAAGGAGGGCATATATAATGCCAAGGAAACTGCTCAGGAGAAAGGTAGCCAAGCAGTAGAACAGGCACAGGAGGCCTTAAAGCGTGCAAAGGAAGCTGGACAGGAGAAAGGAAGCCAGACGGTTGAACAGGCGCAAGAGGCCTTGAAGCGTGCAAAGGATGTTGCACGGG
Fln Alignment:
UniGene Fasta (sense)
