|
||||||
|
UniGene Name: sp_v1.1_unigene67845
Length: 232 nt
Origin of reads:
 UniGene Fasta
|
|---|
| >sp_v1.1_unigene67845
C |
|
Ace file of the UniGene sp_v1.1_unigene67845
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | UDP-glucose glycoprotein:glucosyltransferase, putative; K11718 UDP-glucose:glycoprotein glucosyltransferase [EC:2.4.1.-] | - | - | 6.0e-27 | 85% |
| FL-Next | sp=UDP-glucose:glycoprotein glucosyltransferase; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 82% |
| Blast2go | udp-glucose:glycoprotein glucosyltransferase | - | - | 1.05616e-26 | 90% |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Transferases, Glycosyltransferases, Hexosyltransferases. | EC:2.4.1.- | - | 6.0e-27 | 85% |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | plant-type hypersensitive response | GO:0009626 | Biological Process | 1.05616e-26 | 90% |
| Blast2go | response to salicylic acid stimulus | GO:0009751 | Biological Process | 1.05616e-26 | 90% |
| Blast2go | defense response signaling pathway, resistance gene-independent | GO:0010204 | Biological Process | 1.05616e-26 | 90% |
| Blast2go | anthocyanin metabolic process | GO:0046283 | Biological Process | 1.05616e-26 | 90% |
| Blast2go | transferase activity, transferring glycosyl groups | GO:0016757 | Molecular Function | 1.05616e-26 | 90% |
| Blast2go | endoplasmic reticulum | GO:0005783 | Cellular Component | 1.05616e-26 | 90% |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | UDP-glucose:Glycoprotein Glucosyltransferase | IPR009448 | - | 1.05616e-26 | 90% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q0WL80
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 1257 aas, your sequence is shorter than subject: 76 - 1613
Fln protein:
S
Protein Length:
77
Fln nts:
C
Fln Alignment:
sp_v1.1_unigene67845___NLSQEVRGFIFSKLLERKPEFTADLMEFRDYLLSSTVSDTLDVWELKDLGHQTAQRIVQASDPLHSMQE
Q0WL80_______________DLSQDVRGFIFSKILDRKPELRSEVMAFRDYLLSSTVSDTLDVWELKDLGHQTAQRIVHASDPLQSMQE
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
