SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v1.1

UniGene Name: sp_v1.1_unigene63457

Length: 298 nt

Origin of reads: Uma

This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense

UniGene Fasta (sense)

>sp_v1.1_unigene63457
CTATTAAGTGATTGCACAAAATTTAAGTTTCAATATAGAAATTTTCAGTGATTTTACAAGGGTTGAATCAAAGGAGATCATAAATTGATACATCTTTCTTGTTCTTATTTTATGATTAGGAAAAGGATCCTACTGGCTGCAGTTTTATTCCATTTGGAGGTGGCCAGAGACTTTGTCCAGGTATGGACATGTCAAGGCTAGAAGCTTCCATCTTCTTGCATCAGCTTGTGACCCGATACAGTTGGGAGGCAGAGGATGATTCCATTGTGAGTTTTCCAACAGTCCACATGAAGAAAAG

Ace file of the UniGene sp_v1.1_unigene63457 (antisense)

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	CYP90D6; cytochrome P450 probable 6-deoxoteasterone to 3-dehydro 6-deoxoteasterone or teasterone to 3-dehydro teasterone	-	-	9.0e-18	67%
FL-Next	tr=Cytochrome P450 90A20; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	51%
Blast2go	cytochrome p450	-	-	3.06822e-18	84%

Source	ECs	Term	Type	e value	Identity
Blast2go	Oxidoreductases, Acting on paired donors, with incorporation or reduction of molecular oxygen, With NADH or NADPH as one donor, and incorporation of one atom of oxygen.	EC:1.14.13.-	-	3.06822e-18	84%

Source	KEGGs	Term	e value	Identity
Blast2go	Ubiquinone and other terpenoid-quinone biosynthesis	00130	3.06822e-18	84%
Blast2go	Histidine metabolism	00340	3.06822e-18	84%
Blast2go	Phenylalanine metabolism	00360	3.06822e-18	84%
Blast2go	Chlorocyclohexane and chlorobenzene degradation	00361	3.06822e-18	84%
Blast2go	Bisphenol degradation	00363	3.06822e-18	84%
Blast2go	Tryptophan metabolism	00380	3.06822e-18	84%
Blast2go	Cyanoamino acid metabolism	00460	3.06822e-18	84%
Blast2go	Xylene degradation	00622	3.06822e-18	84%
Blast2go	Toluene degradation	00623	3.06822e-18	84%
Blast2go	Polycyclic aromatic hydrocarbon degradation	00624	3.06822e-18	84%
Blast2go	Chloroalkane and chloroalkene degradation	00625	3.06822e-18	84%
Blast2go	Naphthalene degradation	00626	3.06822e-18	84%
Blast2go	Aminobenzoate degradation	00627	3.06822e-18	84%
Blast2go	Styrene degradation	00643	3.06822e-18	84%
Blast2go	Limonene and pinene degradation	00903	3.06822e-18	84%
Blast2go	Diterpenoid biosynthesis	00904	3.06822e-18	84%
Blast2go	Brassinosteroid biosynthesis	00905	3.06822e-18	84%
Blast2go	Carotenoid biosynthesis	00906	3.06822e-18	84%
Blast2go	Phenylpropanoid biosynthesis	00940	3.06822e-18	84%
Blast2go	Flavonoid biosynthesis	00941	3.06822e-18	84%
Blast2go	Isoflavonoid biosynthesis	00943	3.06822e-18	84%
Blast2go	Stilbenoid, diarylheptanoid and gingerol biosynthesis	00945	3.06822e-18	84%
Blast2go	Isoquinoline alkaloid biosynthesis	00950	3.06822e-18	84%
Blast2go	Glucosinolate biosynthesis	00966	3.06822e-18	84%
Blast2go	Biosynthesis of type II polyketide products	01057	3.06822e-18	84%
Blast2go	Biosynthesis of phenylpropanoids	01061	3.06822e-18	84%
Blast2go	Biosynthesis of terpenoids and steroids	01062	3.06822e-18	84%
Blast2go	Biosynthesis of alkaloids derived from shikimate pathway	01063	3.06822e-18	84%
Blast2go	Biosynthesis of plant hormones	01070	3.06822e-18	84%
Blast2go	Metabolic pathways	01100	3.06822e-18	84%
Blast2go	Biosynthesis of secondary metabolites	01110	3.06822e-18	84%

Source	GOs	Term	Type	e value	Identity
Blast2go	brassinosteroid biosynthetic process	GO:0016132	Biological Process	3.06822e-18	84%
Blast2go	brassinosteroid homeostasis	GO:0010268	Biological Process	3.06822e-18	84%
Blast2go	leaf morphogenesis	GO:0009965	Biological Process	3.06822e-18	84%
Blast2go	monopolar cell growth	GO:0042814	Biological Process	3.06822e-18	84%
Blast2go	petal development	GO:0048441	Biological Process	3.06822e-18	84%
Blast2go	stamen development	GO:0048443	Biological Process	3.06822e-18	84%
Blast2go	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NADH or NADPH as one donor, and incorporation of one atom of oxygen	GO:0016709	Molecular Function	3.06822e-18	84%
Blast2go	binding	GO:0005488	Molecular Function	3.06822e-18	84%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: A9NWM7

Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 16 aas, your sequence is shorter than subject: 98 - 487

Fln protein: IK*LHKI*VSI*KFSVILQGLNQRRS*IDTSFLFLFYD*EKDPTGCSFIPFGGGQRLCPGMDMSRLEASIFLHQLVTRYSWEAEDDSIVSFPTVHMKK

Protein Length: 99

Fln nts: CTATTAAGTGATTGCACAAAATTTAAGTTTCAATATAGAAATTTTCAGTGATTTTACAAGGGTTGAATCAAAGGAGATCATAAATTGATACATCTTTCTTGTTCTTATTTTATGATTAGGAAAAGGATCCTACTGGCTGCAGTTTTATTCCATTTGGAGGTGGCCAGAGACTTTGTCCAGGTATGGACATGTCAAGGCTAGAAGCTTCCATCTTCTTGCATCAGCTTGTGACCCGATACAGTTGGGAGGCAGAGGATGATTCCATTGTGAGTTTTCCAACAGTCCACATGAAGAAAAG

Fln Alignment:

sp_v1.1_unigene63457___TGCSFIPFGGGQRLCPGMDMSRLEASIFLHQLVTRYSWE-AEDDSIVSFPTVHMKK
A9NWM7_______________SGTVFTPFGGGPRLCPGYELARVEISVFLHHMVTLFSWEVVEEDKLIFFPTTRTVK

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain