If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Fln status: Internal

Fln database: tr_plants

Fln subject: B9ST76

Fln msg: Unexpected stop codon in the beginning of your sequence, Unexpected STOP codon at 3' end. Distance to subject end: 590 aas, your sequence is shorter than subject: 93 - 1374

Test code: 0

Test Code was used to find complete genes when there was not found a reliable orthologue. The best ORF (Open Reading Frame) is shown, and only ORFs > 200pb were analyzed. Your ORF will be more reliable if a stop codon was found before the start codon. A Test Code value > 0.95 means the ORF is probably coding. A Test Code value < 0.74 means the ORF is probably non-coding. Test Code values in between 0.74 and 0.95 mean it is uncertain whether the ORF is coding or not.

Fln protein: S*PWLSLNTKKRKIEEFPEVKKQQLYQPSQLIALPSDVNNEDQQDVKGHRSMASSLVLGGVKVCKSRIINFERREFFPQGWTEYVFMLYCHC*

Protein Length: 94

Fln nts: CGTCGTGACCTTGGCTGTCACTCAACACTAAAAAGAGGAAAATTGAAGAGTTCCCAGAAGTAAAGAAGCAACAGCTTTATCAGCCATCGCAATTAATTGCTCTACCCAGTGATGTGAATAATGAAGATCAACAGGATGTCAAAGGACACAGAAGTATGGCTAGTTCACTTGTTCTGGGAGGTGTAAAAGTTTGCAAATCAAGGATTATAAACTTCGAACGCAGAGAATTTTTTCCTCAAGGTTGGACTGAATATGTTTTCATGCTATATTGTCATTGTTAATG

Fln Alignment:

sp_v1.1_unigene56889___LNTKKRKIEEFPEVKKQQLYQPSQLIALPSDV-NNEDQQDVKGHRSMASSLVLGGVKVCKSRIINFERREFFPQG
B9ST76_______________LNCKKNKADDYP-VRKSNTYSPQNLMVCLSNLPNTEDSKDDASAGQLSKSIVGGSMNVCKMRIINFMLADRVVQG