If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: A9NNA8

Fln msg: Distance to subject end: 47 aas, your sequence is shorter than subject: 98 - 222

Test code: 1

Test Code was used to find complete genes when there was not found a reliable orthologue. The best ORF (Open Reading Frame) is shown, and only ORFs > 200pb were analyzed. Your ORF will be more reliable if a stop codon was found before the start codon. A Test Code value > 0.95 means the ORF is probably coding. A Test Code value < 0.74 means the ORF is probably non-coding. Test Code values in between 0.74 and 0.95 mean it is uncertain whether the ORF is coding or not.

Fln protein: CYSNSAPFNRTIMSAPNSANAAPYDPYIPAGAASSNPTGERLGGAGEPLRNGKTQALQQEIDATIGVMRENINKVTERGERLDALQDKTDNLAISAQG

Protein Length: 99

Fln nts: TGCTACTCGAATTCAGCTCCTTTCAATCGTACCATCATGTCCGCTCCCAATTCCGCCAACGCCGCGCCATACGATCCATACATCCCTGCTGGAGCAGCGTCGTCTAACCCTACGGGAGAGCGACTAGGCGGAGCTGGCGAGCCGTTAAGAAATGGGAAGACTCAAGCTCTTCAGCAAGAGATCGATGCTACCATCGGTGTCATGCGAGAAAACaTCAACAAAGTCACTGAAAGAGGAGAGCGTCTCGATGCATTGCAAGACAAGACCGACAACCTCGCTATCTCAGCCCAAGGG

Fln Alignment:

sp_v1.1_unigene55687___PLRNGKTQALQQEIDATIGVMRENINKVTERGERLDALQDKTDNLAISAQ
A9NNA8_______________PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRFQAQ