|
||||||
|
UniGene Name: sp_v1.1_unigene55426
Length: 155 nt
Origin of reads:
 UniGene Fasta
|
|---|
| >sp_v1.1_unigene55426
G |
|
Ace file of the UniGene sp_v1.1_unigene55426
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | ATP-binding cassette transporter (Fragment) n=2 Tax=Selaginella moellendorffii RepID=D8RT17_SELML | - | - | 1.0e-17 | 90% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 76% |
| Blast2go | abc transporter family of the mitochondria family | - | - | 2.61089e-17 | 91% |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | root development | GO:0048364 | Biological Process | 2.61089e-17 | 91% |
| Blast2go | positive regulation of catalytic activity | GO:0043085 | Biological Process | 2.61089e-17 | 91% |
| Blast2go | cellular iron ion homeostasis | GO:0006879 | Biological Process | 2.61089e-17 | 91% |
| Blast2go | pollen development | GO:0009555 | Biological Process | 2.61089e-17 | 91% |
| Blast2go | chloroplast organization | GO:0009658 | Biological Process | 2.61089e-17 | 91% |
| Blast2go | response to cadmium ion | GO:0046686 | Biological Process | 2.61089e-17 | 91% |
| Blast2go | response to cold | GO:0009409 | Biological Process | 2.61089e-17 | 91% |
| Blast2go | response to lead ion | GO:0010288 | Biological Process | 2.61089e-17 | 91% |
| Blast2go | regulation of multicellular organism growth | GO:0040014 | Biological Process | 2.61089e-17 | 91% |
| Blast2go | positive regulation of abscisic acid mediated signaling pathway | GO:0009789 | Biological Process | 2.61089e-17 | 91% |
| Blast2go | response to oxidative stress | GO:0006979 | Biological Process | 2.61089e-17 | 91% |
| Blast2go | regulation of chlorophyll biosynthetic process | GO:0010380 | Biological Process | 2.61089e-17 | 91% |
| Blast2go | enzyme activator activity | GO:0008047 | Molecular Function | 2.61089e-17 | 91% |
| Blast2go | transporter activity | GO:0005215 | Molecular Function | 2.61089e-17 | 91% |
| Blast2go | ATPase activity | GO:0016887 | Molecular Function | 2.61089e-17 | 91% |
| Blast2go | binding | GO:0005488 | Molecular Function | 2.61089e-17 | 91% |
| Blast2go | chloroplast envelope | GO:0009941 | Cellular Component | 2.61089e-17 | 91% |
| Blast2go | apoplast | GO:0048046 | Cellular Component | 2.61089e-17 | 91% |
| Blast2go | stromule | GO:0010319 | Cellular Component | 2.61089e-17 | 91% |
| Blast2go | phragmoplast | GO:0009524 | Cellular Component | 2.61089e-17 | 91% |
| Blast2go | chloroplast stroma | GO:0009570 | Cellular Component | 2.61089e-17 | 91% |
| Blast2go | chloroplast thylakoid | GO:0009534 | Cellular Component | 2.61089e-17 | 91% |
| Blast2go | cell plate | GO:0009504 | Cellular Component | 2.61089e-17 | 91% |
| Blast2go | nucleus | GO:0005634 | Cellular Component | 2.61089e-17 | 91% |
| Blast2go | mitochondrion | GO:0005739 | Cellular Component | 2.61089e-17 | 91% |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Protein of unknown function DUF1602 | IPR011633 | - | 2.61089e-17 | 91% |
| Full-Lengther Next Prediction |
|---|
Fln status: Putative C-terminus
Fln database: coniferopsida.fasta
Fln subject: A9NW03
Fln msg: STOP codon was not found. Distance to subject end: 6 aas, your sequence is shorter than subject: 51 - 636
Fln protein:
Q
Protein Length:
52
Fln nts:
G
Fln Alignment:
sp_v1.1_unigene55426___YQTRVGERGLKLSGGEKQRVALARAFLKSPPIFLCDEATSALDSTTEAEI
A9NW03_______________YMTVVGERGLKLSGGEKQRVAIARAFLKAPRLLICDEATSALDSSTEVPV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
