If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Fln status: N-terminus

Fln database: coniferopsida.fasta

Fln subject: Q8L8J0

Fln msg: Overlapping hits, possible frame ERROR between 259 and 256, and overlapping frame ERROR between 414 and 414, Distance to subject end: 262 aas, your sequence is shorter than subject: 95 - 348

Test code: 0

Test Code was used to find complete genes when there was not found a reliable orthologue. The best ORF (Open Reading Frame) is shown, and only ORFs > 200pb were analyzed. Your ORF will be more reliable if a stop codon was found before the start codon. A Test Code value > 0.95 means the ORF is probably coding. A Test Code value < 0.74 means the ORF is probably non-coding. Test Code values in between 0.74 and 0.95 mean it is uncertain whether the ORF is coding or not.

Fln protein: MASSSSSTFSSAAADSSNKSHQVFINHRxxxVKKTFARSLYRRLREKGLTAFFDEEEMQGGCEISSQLADAIRTASVHVAxxxPRYAESEWCLNE

Protein Length: 96

Fln nts: CGTCGTGACCTTGGCTGTCACTCAAATTTTTCCACAATTCCTCGTGCCCTTTTAGTACCCAATCTTCTGCAATTTCTCTGCGCTTTTAAAACAGTGAATCGTCTCTGTGCAGACTCTGCGTCCATAGCATCCAACCATTACTACCTTAATTTCTGTTTTGATCTGGGCA_-_ATGGCATCATCTTCATCCTCCACCTTTTCCTCGGCTGCTGCTGATTCCAGCAACAAATCCCACCAAGTTTTTATAAACCATCGCxxxxxxxxxGTGAAGAAAACCTTCGCCAGGTCTCTCTACCGTCGCCTTCGCGAGAAAGGATTGACGGCTTTCTTCGATGAGGAGGAGATGCAAGGGGGATGTGAAATTTCTTCTCAACTCGCAGACGCTATTAGGACCGCCTCAGTTCACGTGGCGCTxxxxxxTCCTCGATACGCTGAATCGGAATGGTGCCTCAATGAG

Fln Alignment:

sp_v1.1_unigene33529___NKSHQVFINHRGxDVKKTFARSLYRRLREKGLTAFFDEEEMQGGCEISSQLADAIRTASVHVALFSPRYAESEWCLNE
Q8L8J0_______________NKSHQVFINHRGxDVKKTFVRSLYRRLREKGLTAFFNEEEMQGGCEISSQLADAIRTASVHVAIFSPRYVESEWCLNE