|
||||||
|
UniGene Name: sp_v1.1_unigene13060
Length: 242 nt
Origin of reads:
 UniGene Fasta
|
|---|
| >sp_v1.1_unigene13060
A |
|
Ace file of the UniGene sp_v1.1_unigene13060
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | glycerol-3-phosphate dehydrogenase, putative (EC:1.1.1.94) | - | - | 2.0e-28 | 91% |
| FL-Next | tr=Os07g0229800 protein; Oryza sativa subsp. japonica (Rice). | - | - | 0.0 | 91% |
| Blast2go | glycerol-3-phosphate dehydrogenase | - | - | 1.0992e-28 | 92% |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Beta-lactamase. | EC:3.5.2.6 | - | 1.0992e-28 | 92% |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Penicillin and cephalosporin biosynthesis | 00311 | 1.0992e-28 | 92% | |
| Blast2go | Biosynthesis of secondary metabolites | 01110 | 1.0992e-28 | 92% | |
| Blast2go | Glycerol-3-phosphate dehydrogenase (NAD(P)(+)). | EC:1.1.1.94 | - | 1.0992e-28 | 92% |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Glycerophospholipid metabolism | 00564 | 1.0992e-28 | 92% | |
| Blast2go | Glycerol-3-phosphate dehydrogenase (NAD(+)). | EC:1.1.1.8 | - | 1.0992e-28 | 92% |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Glycerophospholipid metabolism | 00564 | 1.0992e-28 | 92% | |
| Blast2go | Hydroxyacylglutathione hydrolase. | EC:3.1.2.6 | - | 1.0992e-28 | 92% |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Pyruvate metabolism | 00620 | 1.0992e-28 | 92% |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | glycerolipid biosynthetic process | GO:0045017 | Biological Process | 1.0992e-28 | 92% |
| Blast2go | oxidation-reduction process | GO:0055114 | Biological Process | 1.0992e-28 | 92% |
| Blast2go | methylglyoxal catabolic process to D-lactate | GO:0019243 | Biological Process | 1.0992e-28 | 92% |
| Blast2go | systemic acquired resistance | GO:0009627 | Biological Process | 1.0992e-28 | 92% |
| Blast2go | glycerol-3-phosphate catabolic process | GO:0046168 | Biological Process | 1.0992e-28 | 92% |
| Blast2go | beta-lactamase activity | GO:0008800 | Molecular Function | 1.0992e-28 | 92% |
| Blast2go | metal ion binding | GO:0046872 | Molecular Function | 1.0992e-28 | 92% |
| Blast2go | glycerol-3-phosphate dehydrogenase [NAD(P)+] activity | GO:0047952 | Molecular Function | 1.0992e-28 | 92% |
| Blast2go | NAD binding | GO:0051287 | Molecular Function | 1.0992e-28 | 92% |
| Blast2go | glycerol-3-phosphate dehydrogenase [NAD+] activity | GO:0004367 | Molecular Function | 1.0992e-28 | 92% |
| Blast2go | hydroxyacylglutathione hydrolase activity | GO:0004416 | Molecular Function | 1.0992e-28 | 92% |
| Blast2go | glycerol-3-phosphate dehydrogenase complex | GO:0009331 | Cellular Component | 1.0992e-28 | 92% |
| Blast2go | plastid | GO:0009536 | Cellular Component | 1.0992e-28 | 92% |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Glycerol-3-phosphate dehydrogenase, NAD-dependent, C-terminal | IPR006109 | - | 1.0992e-28 | 92% |
| Blast2go | Glycerol-3-phosphate dehydrogenase, NAD-dependent | IPR006168 | - | 1.0992e-28 | 92% |
| Blast2go | 6-phosphogluconate dehydrogenase, C-terminal-like | IPR008927 | - | 1.0992e-28 | 92% |
| Blast2go | Dehydrogenase, multihelical | IPR013328 | - | 1.0992e-28 | 92% |
| Full-Lengther Next Prediction |
|---|
Fln status: C-terminus
Fln database: tr_plants
Fln subject: Q8H2J9
Fln msg: your sequence is shorter than subject: 72 - 254
Fln protein:
R
Protein Length:
73
Fln nts:
A
Fln Alignment:
sp_v1.1_unigene13060___RLGSGEKLDDILASMNQVAEGVATAGAVIALAQKYHVKMPVLTAVARIIDNELTPKRAVLELMNLPQVEEV
Q8H2J9_______________RLGSGEKLDEIMNSMNQVAEGVSTAGAVIALAQKYHVKMPVLTAVARIIDNELTPKKAVMELMNLPQVEEV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
