SustainPineDB

Assembly Name: SustainPine v1.1

UniGene Name: sp_v1.1_unigene5201

Length: 524 nt

Origin of reads: Biogeco_1 Uma

UniGene Fasta

Ace file of the UniGene sp_v1.1_unigene5201

Annotations

Source	Descriptions	Term	Type	Identity
AutoFact	glutamate synthase (ferredoxin); K00284 glutamate synthase (ferredoxin) [EC:1.4.7.1]	-	-	89%
FL-Next	sp=Ferredoxin-dependent glutamate synthase, chloroplastic; Zea mays (Maize).	-	-	74%
Blast2go	ferredoxin-dependent glutamate synthase	-	-	93%

Source	ECs	Term	Type	e value	Identity
Blast2go	Glutamate synthase (ferredoxin).	EC:1.4.7.1	-	0.0	93%

Source	KEGGs	Term	Type	e value	Identity
Blast2go	Nitrogen metabolism	00910		0.0	93%

Source	ECs	Term	Type	e value	Identity
AutoFact	Glutamate synthase (ferredoxin).	EC:1.4.7.1	-	0.0	89%

Source	KEGGs	Term	Type	e value	Identity
AutoFact	Nitrogen metabolism	00910		0.0	89%

Source	GOs	Term	Type	Identity
Blast2go	response to light stimulus	GO:0009416	Biological Process	93%
Blast2go	photorespiration	GO:0009853	Biological Process	93%
Blast2go	positive regulation of glycine hydroxymethyltransferase activity	GO:0080114	Biological Process	93%
Blast2go	glutamate synthase (ferredoxin) activity	GO:0016041	Molecular Function	93%
Blast2go	protein binding	GO:0005515	Molecular Function	93%
Blast2go	mitochondrion	GO:0005739	Cellular Component	93%
Blast2go	chloroplast stroma	GO:0009570	Cellular Component	93%
Blast2go	membrane	GO:0016020	Cellular Component	93%
Blast2go	apoplast	GO:0048046	Cellular Component	93%

Source	InterPros	Term	Type	e value	Identity
Blast2go	Glutamate synthase, central-N	IPR006982	-	0.0	93%
Blast2go	Aldolase-type TIM barrel	IPR013785	-	0.0	93%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: sp_plants

Fln subject: P23225

Fln msg: Overlapping hits, possible frame ERROR between 109 and 109, Distance to subject end: 756 aas, your sequence is shorter than subject: 174 - 1616

Test code: 0

Test Code was used to find complete genes when there was not found a reliable orthologue. The best ORF (Open Reading Frame) is shown, and only ORFs > 200pb were analyzed. Your ORF will be more reliable if a stop codon was found before the start codon. A Test Code value > 0.95 means the ORF is probably coding. A Test Code value < 0.74 means the ORF is probably non-coding. Test Code values in between 0.74 and 0.95 mean it is uncertain whether the ORF is coding or not.

Fln protein: RLCEAADEAVRGGSHLLILSDRADELEPTRPAIPIxxAAGAVHQHLIQNGLRMSASIIADTAQCFSTHHFACLIGYGVSAVCPYLALETCRQWRLSAKAENMMRNGKMPTVTIEQAQKNFGKAIKAGLLKILSKMGISLLSSYCGAQIFEIYGLGKEVVDIAFCGSVSRVGGLN

Protein Length: 175

Fln nts: CAGACTCTGTGAAGCTGCAGATGAGGCTGTTCGAGGTGGTTCACATCTGTTAATCCTCAGTGATCGTGCCGATGAATTGGAACCAACTAGGCCAGCAATTCCTATTxxxxxxGCAGCTGGAGCTGTTCATCAACACCTCATTCAAAATGGCTTGCGTATGTCAGCATCGATAATTGCTGATACAGCTCAATGTTTTAGTACACATCATTTTGCTTGCCTAATTGGCTATGGTGTGAGTGCTGTTTGTCCATATCTGGCACTGGAGACATGTCGTCAATGGCGTCTGAGTGCCAAAGCTGAAAATATGATGAGGAATGGGAAAATGCCAACAGTTACAATCGAGCAAGCTCAGAAGAATTTTGGCAAGGCAATTAAGGCTGGCCTTTTGAAGATACTCTCAAAGATGGGTATCTCGTTGCTTTCTAGTTATTGTGGAGCACAAATTTTTGAGATATATGGGCTAGGTAAAGAAGTGGTTGACATAGCATTTTGTGGGAGTGTCTCCCGAGTTGGTGGTTTGAATAT

Fln Alignment:

sp_v1.1_unigene5201___LCEAADEAVRGGSHLLILSDRADELEPTRPAIPILLAAGAVHQHLIQNGLRMSASIIADTAQCFSTHHFACLIGYGVSAVCPYLALETCRQWRLSAKAENMMRNGKMPTVTIEQAQKNFGKAIKAGLLKILSKMGISLLSSYCGAQIFEIYGLGKEVVDIAFCGSVSRVGGL
P23225______________LCEEADAAVRSGSQLLVLSDRSEAPEPTRPAIPILLAVGAIHQHLIQNGLRMSASIVADTAQCFSTHHFACLIGYGASAVCPYLALETCRQWRLSNKTLNLMRNGKMPTVTIEQAQRNFIKAVKSGLLKILSKMGISLLSSYCGAQIFEIYGLGQEVVDLAFCGSVSKIGGL

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain