If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Fln status: Putative C-terminus

Fln database: coniferopsida.fasta

Fln subject: A9NRE1

Fln msg: ERROR#3, very serious frame error, warning!, putative chimeric sequence! or repetitive structure STOP codon was not found. Distance to subject end: 1 aas, atg_distance in limit (1-15): atg_distance = 33, No stop codon before M and M found is too far from subject M, your sequence is shorter than subject: 178 - 378

Test code: 1

Test Code was used to find complete genes when there was not found a reliable orthologue. The best ORF (Open Reading Frame) is shown, and only ORFs > 200pb were analyzed. Your ORF will be more reliable if a stop codon was found before the start codon. A Test Code value > 0.95 means the ORF is probably coding. A Test Code value < 0.74 means the ORF is probably non-coding. Test Code values in between 0.74 and 0.95 mean it is uncertain whether the ORF is coding or not.

Fln protein: MPISTSTAEKHPLQPTNIAFNGPETEEDDKKRDREHKKRSKNWTRVETLKLIKLRTEFEPRFSRSGRKTELWDEIAESLxxxxVFRDAQQCRDKWEKLMAGFKDVREGLKDRNDNPYYEDLHPLLSGKCLRRENLKKEGDSTHNENLNSRHLEISGREMYENRDNGIEGIDEDLLLEK

Protein Length: 179

Fln nts: TGGCGACACATGTATAGTTCCATACATCATGCCCATTTCCACCTCTACCGCaGAAAAACACCCTCTCCAGCCAACCAATATCGCCTTTAACGGCCCGGAAACAGAGGAAGACGACAAGAAACGGGATAGAGAGCACAAGAAGCGGTCCAAGAACTGGACCAGGGTCGAAACCCTCAAGCTTATAAAGCTTCGAACAGAATTTGAGCCCAGGTTTTCTCGCAGCGGAAGAAAGACGGAACTCTGGGACGAAATAGCTGAGTCTCTGxxxxxxxxxxxxGTTTTCAGGGACGCCCAGCAGTGCAGAGACAAATGGGAGAAATTAATGGCGGGTTTTAAAGATGTTAGGGAGGGTTTGAAAGATAGGAACGATAACCCTTATTATGAGGATCTCCATCCTTTGCTTTCCGGCAAATGCCTGCGCAGGGAGAACCTCAAGAAGGAAGGAGATTCTACCCATAACGAGAATTTGAACTCTCGGCATTTGGAGATTTCCGGCAGGGAAATGTATGAGAATCGGGACAACGGAATAGAAGGAATAGATGAGGATTTGCTGTTGGAAAAGCC

Fln Alignment:

sp_v1.1_unigene4517___xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
A9NRE1______________xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx