UniGene Name: sp_v3.0_unigene210475
Length: 213 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
![]() |
---|
>sp_v3.0_unigene210475
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | serine/threonine-protein kinase PBS1 [Arabidopsis thaliana] sp|Q9FE20.1|PBS1_ARATH RecName: Full=Serine/threonine-protein kinase PBS1; AltName: Full=AvrPphB susceptible protein 1 gb|AAG38109.1|AF314176_1 protein serine/threonine kinase PBS1 [Arabidopsis t | - | - | 2.0e-33 | 94% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 92% |
Sma3 | Receptor serine-threonine protein kinase, putative | - | - | 5.436e-32 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Non-specific protein-tyrosine kinase. | EC:2.7.10.2 | - | 1.421e-19 | - |
Source | Gene names |
---|---|
Sma3 | 673I14.2; APK2b; AT4g13190; At1g07870; At1g20650; At1g76370; At2g02800; At2g02800/T20F6.6; At2g28590; At3g02810; At3g07070; At3g20530; At3g24790; At3g26940; At4g13190; At5g01020; At5g01020/F7J8_5; At5g02800; At5g18610; At5g56460; B1130E07.8; B1144B06.39; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
Sma3 | protein kinase activity | GO:0004672 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Serine-threonine/tyrosine-protein kinase catalytic domain | IPR001245 | - | 0.0 | - |
Sma3 | Zinc finger, C2H2 | IPR007087 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - | |
Sma3 | ABC transporter, conserved site | IPR017871 | - | 0.0 | - |
Sma3 | WD40 repeat, conserved site | IPR019775 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G13160.1 | PBS1 Protein kinase superfamily protein chr5:4176854-4179682 FORWARD LENGTH=456 | 1.99965e-42 | 94% |
RefSeq | Arabidopsis thaliana | NP_196820.1 | serine/threonine-protein kinase PBS1 [Arabidopsis thaliana] | 3.00018e-42 | 94% |
RefSeq | Populus trichocarpa | XP_002312759.1 | serine/threonine protein kinase PBS1, partial [Populus trichocarpa] | 2.00386e-43 | 97% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5AAA3
Fln msg: Distance to subject end: 187 aas, your sequence is shorter than subject: 70 - 458
Fln protein:
G
Protein Length:
71
Fln nts:
A
Fln Alignment:
uma_euler_23289___GAARGLEYLHDKANPPVIYRDFKSSNILLDEGFHPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEYA
D5AAA3________________GAAKGLEYLHDKANPPVIYRDLKCSNILLDEGYHSKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEYA
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain