|
||||||
|
UniGene Name: sp_v3.0_unigene210465
Length: 174 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene210465
T |
|
Ace file of the UniGene sp_v3.0_unigene210465 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Cellulose synthase-like C1, glycosyltransferase family 2 n=3 Tax=Physcomitrella patens RepID=E1C9S6_PHYPA | - | - | 9.0e-23 | 90% |
| FL-Next | tr=Cellulose synthase-like A1; Pinus taeda (Loblolly pine). | - | - | 0.0 | 50% |
| Sma3 | Cellulose synthase-like protein C4 | - | - | 3.018e-08 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Transferases, Glycosyltransferases, Hexosyltransferases. | EC:2.4.1.- | - | 5.513e-26 | - |
| Source | Gene names |
|---|---|
| Sma3 | At2g24630; At3g07330; At3g28180; At4g07960; At4g31590; CSLC1; CSLC10; CSLC12; CSLC2; CSLC3; CSLC4; CSLC5; CSLC6; CSLC7; CSLC8; CSLC9; CslC1; CslC2; CslC3; F1K3.3; F21O3.4; F25P17.7; F28M20.220; GSVIVT00000743001; GSVIVT00008341001; GSVIVT00014999001; GSVI |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Golgi membrane | GO:0000139 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | transferase activity | GO:0016740 | Molecular Function | 0.0 | - |
| Sma3 | transferase activity, transferring glycosyl groups | GO:0016757 | Molecular Function | 0.0 | - |
| Sma3 | cellular cell wall organization | GO:0007047 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glycosyl transferase, family 2 | IPR001173 | - | 0.0 | - |
| Sma3 | Inorganic pyrophosphatase | IPR008162 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G07960.1 | ATCSLC12, CSLC12 Cellulose-synthase-like C12 chr4:4802628-4805114 REVERSE LENGTH=699 | 8.0e-27 | 78% |
| RefSeq | Arabidopsis thaliana | NP_192536.1 | putative xyloglucan glycosyltransferase 12 [Arabidopsis thaliana] | 1.0e-26 | 78% |
| RefSeq | Populus trichocarpa | XP_002335918.1 | predicted protein [Populus trichocarpa] | 2.0e-28 | 84% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A3QT94
Fln msg: Distance to subject end: 177 aas, your sequence is shorter than subject: 57 - 530
Fln protein:
N
Protein Length:
58
Fln nts:
T
Fln Alignment:
biogeco3_euler_8212___GWKFIFLDDVKCLCELPESYEAYRKQQHRWHSGPMQLFRLCLPDIIRSKEIGFSKK
A3QT94________________GWKFVFVGDLKVKNELPSTFKAYRYQQHRWSCGPANLFRKMVMEILRNKRVTPWKK
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
