SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene210455

Length: 141 nt

UniGene Fasta

>sp_v3.0_unigene210455
TCAAACCCTGTTCACAAGAAGATTCCAGTGCTTATCCACAATGGAAAGCCTGTTTGTGAATCCATGATTATTGTGCAGTACATCGAGGAGGTATGGGGCAATAAGGCAACCAAATCTTATGCCCAAAGATCCATATGACCG

Ace file of the UniGene sp_v3.0_unigene210455

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Tau class glutathione S-transferase n=3 Tax=Pinus RepID=Q4PNY9_PINTB	-	-	1.0e-13	86%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	91%
Sma3	Glutathione S-transferase	-	-	7.195e-33	-

Source	ECs	Term	Type	e value	Identity
Sma3	Glutathione transferase.	EC:2.5.1.18	-	2.741e-21	-

Source	KEGGs	Term	Type	e value	Identity
Sma3	Glutathione metabolism	00480		2.741e-21	%
Sma3	Metabolism of xenobiotics by cytochrome P450	00980		2.741e-21	%
Sma3	Drug metabolism - cytochrome P450	00982		2.741e-21	%
Sma3	Lactoylglutathione lyase.	EC:4.4.1.5	-	7.622e-18	-

Source	KEGGs	Term	Type	e value	Identity
Sma3	Pyruvate metabolism	00620		7.622e-18	%

Source	Gene names
Sma3	At1g17170; At1g17180; At1g17180/F20D23_12; At1g78320; At1g78340; At1g78340/F3F9_13; At1g78370; At1g78380; At3g43800; BI-GST/GPX; C-7; EgHypar; F20D23.12; F20D23.13; GST; GST1; GST2; GST5; GSTU1; GSTU2; GSTa; GSVIVT00000218001; GSVIVT00000966001; GSVIVT000

Source	GOs	Term	Type	Identity
Sma3	cytoplasm	GO:0005737	Cellular Component	-
Sma3	plasma membrane	GO:0005886	Cellular Component	-
Sma3	chloroplast	GO:0009507	Cellular Component	-
Sma3	chloroplast stroma	GO:0009570	Cellular Component	-
Sma3	apoplast	GO:0048046	Cellular Component	-
Sma3	glutathione transferase activity	GO:0004364	Molecular Function	-
Sma3	lactoylglutathione lyase activity	GO:0004462	Molecular Function	-
Sma3	peroxidase activity	GO:0004601	Molecular Function	-
Sma3	transferase activity	GO:0016740	Molecular Function	-
Sma3	glutathione binding	GO:0043295	Molecular Function	-
Sma3	response to oxidative stress	GO:0006979	Biological Process	-
Sma3	toxin catabolic process	GO:0009407	Biological Process	-
Sma3	auxin mediated signaling pathway	GO:0009734	Biological Process	-
Sma3	cellular response to water deprivation	GO:0042631	Biological Process	-
Sma3	response to cadmium ion	GO:0046686	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Glutathione S-transferase, N-terminal	IPR004045	-	-
Sma3	Glutathione S-transferase, C-terminal	IPR004046	-	-
Sma3	Glutathione S-transferase, C-terminal-like	IPR010987	-	-
Sma3		IPR012335	-	-
Sma3	Glutathione S-transferase/chloride channel, C-terminal	IPR017933	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT1G78340.1	ATGSTU22, GSTU22 glutathione S-transferase TAU 22 chr1:29473046-29473797 REVERSE LENGTH=218	7.0e-16	85%
RefSeq	Arabidopsis thaliana	NP_177956.1	glutathione S-transferase TAU 22 [Arabidopsis thaliana]	9.0e-16	85%
RefSeq	Populus trichocarpa	XP_002338140.1	predicted protein, partial [Populus trichocarpa]	3.0e-16	80%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: B8LKJ5

Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 133 aas, your sequence is shorter than subject: 46 - 233

Fln protein: SNPVHKKIPVLIHNGKPVCESMIIVQYIEEVWGNKATKSYAQRSI*

Protein Length: 47

Fln nts: TCAAACCCTGTTCACAAGAAGATTCCAGTGCTTATCCACAATGGAAAGCCTGTTTGTGAATCCATGATTATTGTGCAGTACATCGAGGAGGTATGGGGCAATAAGGCAACCAAATCTTATGCCCAAAGATCCATATGACCG

Fln Alignment:

Ac_Euler_7604___SNPVHKKIPVLIHNGKPVCESMIIVQYIEEVWGNKA
B8LKJ5________________SNPVHKKIPVLIHNGKPVCESMIIVQYIEEAWDSKA

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain