|
||||||
|
UniGene Name: sp_v3.0_unigene210063
Length: 173 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene210063
A |
|
Ace file of the UniGene sp_v3.0_unigene210063
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Reverse transcriptase (Fragment) n=1 Tax=Cycas revoluta RepID=Q56GG4_CYCRE | - | - | 7.0e-20 | 80% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 59% |
| Sma3 | Retrotransposon protein, putative, unclassified | - | - | 6.091e-29 | - |
| Source | Gene names |
|---|---|
| Sma3 | F23H6.1; H0124B04.16; H0321H01.8; LOC_Os03g05340; LOC_Os03g05350; LOC_Os03g06110; LOC_Os03g07050; LOC_Os03g10000; LOC_Os03g13350; LOC_Os03g26020; LOC_Os03g61190; LOC_Os10g06110; LOC_Os10g10350; LOC_Os10g13960; LOC_Os10g16880; LOC_Os10g28310; LOC_Os10g3761 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | chromatin | GO:0000785 | Cellular Component | 0.0 | - |
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | ribosome | GO:0005840 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | chromatin binding | GO:0003682 | Molecular Function | 0.0 | - |
| Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
| Sma3 | structural constituent of ribosome | GO:0003735 | Molecular Function | 0.0 | - |
| Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
| Sma3 | carbonate dehydratase activity | GO:0004089 | Molecular Function | 0.0 | - |
| Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | triglyceride lipase activity | GO:0004806 | Molecular Function | 0.0 | - |
| Sma3 | transporter activity | GO:0005215 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | sugar binding | GO:0005529 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | GO:0008415 | Molecular Function | 0.0 | - | |
| Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
| Sma3 | chromatin assembly or disassembly | GO:0006333 | Biological Process | 0.0 | - |
| Sma3 | translation | GO:0006412 | Biological Process | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
| Sma3 | lipid metabolic process | GO:0006629 | Biological Process | 0.0 | - |
| Sma3 | transport | GO:0006810 | Biological Process | 0.0 | - |
| Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
| Sma3 | carbon utilization | GO:0015976 | Biological Process | 0.0 | - |
| Full-Lengther Next Prediction |
|---|
Fln status: C-terminus
Fln database: coniferopsida.fasta
Fln subject: A9NWN2
Fln msg: your sequence is shorter than subject: 38 - 66
Fln protein:
R
Protein Length:
39
Fln nts:
A
Fln Alignment:
uma_euler_11398___RELNKLTIKDKFPIPVIDELLDELHGSIYFTRLDLRS*YHQIRM
A9NWN2________________RVLNEITIKDKFHISIVDELLDELYGTMYFLELDQKSNYYHIRV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
