|
||||||
|
UniGene Name: sp_v3.0_unigene210049
Length: 218 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene210049
A |
|
Ace file of the UniGene sp_v3.0_unigene210049
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | cytochrome P450 [Pyrus communis] | - | - | 4.0e-15 | 63% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 84% |
| Sma3 | Cytochrome P450-dependent monooxygenase | - | - | 2.304e-13 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Flavonoid 3',5'-hydroxylase. | EC:1.14.13.88 | - | 1.971e-12 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Flavonoid biosynthesis | 00941 | 1.971e-12 | % | |
| Sma3 | Flavone and flavonol biosynthesis | 00944 | 1.971e-12 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 1.971e-12 | % |
| Source | Gene names |
|---|---|
| Sma3 | At1g01280; At1g28430; At1g74540; At1g74550; At2g05180; At3g20120/MAL21_16; At5g06900; At5g42580; C3H2; C3H3; CYP703A4; CYP712A4P; CYP71B40-1; CYP736A3v2; CYP736A5v1; CYP736A9; CYP750A1; CYP76X3; CYP84A17; CYP93A1; CYP98A1; CYP98A10; CYP98A11; CYP98A6; F1M |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | monooxygenase activity | GO:0004497 | Molecular Function | 0.0 | - |
| Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
| Sma3 | oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NADH or NADPH as one donor, and incorporation of one atom of oxygen | GO:0016709 | Molecular Function | 0.0 | - |
| Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
| Sma3 | pollen wall assembly | GO:0010208 | Biological Process | 0.0 | - |
| Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
| Sma3 | medium-chain fatty acid metabolic process | GO:0051791 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Cytochrome P450 | IPR001128 | - | 0.0 | - |
| Sma3 | Aminoacyl-tRNA synthetase, class I, conserved site | IPR001412 | - | 0.0 | - |
| Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
| Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
| Sma3 | Cytochrome P450, E-class, group I | IPR002401 | - | 0.0 | - |
| Sma3 | Reverse transcriptase, RNA-dependent DNA polymerase | IPR013103 | - | 0.0 | - |
| Sma3 | Cytochrome P450, conserved site | IPR017972 | - | 0.0 | - |
| Sma3 | IPR017973 | - | 0.0 | - | |
| Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G66540.1 | Cytochrome P450 superfamily protein chr1:24824837-24826502 FORWARD LENGTH=386 | 9.0e-20 | 52% |
| RefSeq | Arabidopsis thaliana | NP_001117558.1 | putative cytochrome P450 [Arabidopsis thaliana] | 6.0e-20 | 52% |
| RefSeq | Populus trichocarpa | XP_002334744.1 | cytochrome P450, partial [Populus trichocarpa] | 7.0e-22 | 65% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LNX9
Fln msg: Distance to subject end: 132 aas, your sequence is shorter than subject: 72 - 462
Fln protein:
I
Protein Length:
73
Fln nts:
A
Fln Alignment:
uma_euler_4259___IEWAMSEALRNPAVMKKLQDELESVVGLGRMVCESDLPKLLYLQAAVKETLRLHPSGPLLVRHLFGTASCNV
B8LNX9________________IEWAMSEALRNPPVMKKLQDELERVVGLGRMVCESDLPRLVYLQAVVKETLRLYPSGPFLTRHL-SAASCNV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
