UniGene Name: sp_v3.0_unigene209994
Length: 125 nt
UniGene Fasta |
---|
>sp_v3.0_unigene209994
G |
Ace file of the UniGene sp_v3.0_unigene209994 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Type IIIa membrane protein cp-wap13 n=1 Tax=Vigna unguiculata RepID=O24548_VIGUN | - | - | 2.0e-16 | 92% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 97% |
Sma3 | Alpha-1,4-glucan-protein synthase [UDP-forming], putative | - | - | 4.403e-15 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Transferases, Glycosyltransferases, Hexosyltransferases. | EC:2.4.1.- | - | 1.749e-08 | - |
Source | Gene names |
---|---|
Sma3 | 8C01; At3g02230; At3g08900; At5g15650; At5g16510; At5g50750; AtRGP; BA12; CHLREDRAFT_187866; EZY11; F14F8_30; F14P3.12; GRPL1; GRPL2; GSVIVT00000015001; GSVIVT00017950001; GSVIVT00025128001; GSVIVT00030012001; GSVIVT00038072001; LOC_Os03g40270; MtrDRAFT_A |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | extracellular region | GO:0005576 | Cellular Component | 0.0 | - |
Sma3 | Golgi apparatus | GO:0005794 | Cellular Component | 0.0 | - |
Sma3 | plant-type cell wall | GO:0009505 | Cellular Component | 0.0 | - |
Sma3 | cytosolic ribosome | GO:0022626 | Cellular Component | 0.0 | - |
Sma3 | cell junction | GO:0030054 | Cellular Component | 0.0 | - |
Sma3 | transferase activity, transferring hexosyl groups | GO:0016758 | Molecular Function | 0.0 | - |
Sma3 | GO:0047210 | Molecular Function | 0.0 | - | |
Sma3 | cellular cell wall organization | GO:0007047 | Biological Process | 0.0 | - |
Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
Sma3 | cellulose biosynthetic process | GO:0030244 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Alpha-1,4-glucan-protein synthase, UDP-forming | IPR004901 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G02230.1 | RGP1, ATRGP1 reversibly glycosylated polypeptide 1 chr3:415463-417304 FORWARD LENGTH=357 | 7.0e-22 | 90% |
RefSeq | Arabidopsis thaliana | NP_186872.1 | reversibly glycosylated polypeptide 1 [Arabidopsis thaliana] | 9.0e-22 | 90% |
RefSeq | Populus trichocarpa | XP_002316078.1 | predicted protein [Populus trichocarpa] | 7.0e-23 | 92% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NKS5
Fln msg: Distance to subject end: 182 aas, your sequence is shorter than subject: 41 - 363
Fln protein:
D
Protein Length:
42
Fln nts:
G
Fln Alignment:
uma_euler_39108___DPYREGADFVRGYPFSLRHGTPTAVSHGLWMNIPDYDAPTQ
A9NKS5________________DPYRDGADFVRGYPFSLRHGTPTAVSHGLWMNIPDYDAPTQ
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain