UniGene Name: sp_v3.0_unigene208871
Length: 98 nt
![]() |
---|
>sp_v3.0_unigene208871
G |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Serine hydroxymethyltransferase n=4 Tax=Arabidopsis RepID=Q8GRI1_ARATH | - | - | 1.0e-10 | 100% |
FL-Next | sp=Serine hydroxymethyltransferase; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 100% |
Sma3 | Serine hydroxymethyltransferase | - | - | 0.0 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Glycine hydroxymethyltransferase. | EC:2.1.2.1 | - | 0.0 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Glycine, serine and threonine metabolism | 00260 | 0.0 | % | |
Sma3 | Cyanoamino acid metabolism | 00460 | 0.0 | % | |
Sma3 | One carbon pool by folate | 00670 | 0.0 | % | |
Sma3 | Methane metabolism | 00680 | 0.0 | % | |
Sma3 | Metabolic pathways | 01100 | 0.0 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 0.0 | % |
Source | Gene names |
---|---|
Sma3 | AT4g13890; AT4g32520; AT5G26780; At4g13890; At4g37930; At5g26780; CHLREDRAFT_194461; CHLREDRAFT_196354; CHLREDRAFT_196400; F18A5.280; F20D10.50; F8B4.220; GSVIVT00005296001; GSVIVT00005330001; GSVIVT00011492001; GSVIVT00011494001; GSVIVT00015058001; GSVIV |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | cytosolic ribosome | GO:0022626 | Cellular Component | 0.0 | - |
Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
Sma3 | sequence-specific DNA binding transcription factor activity | GO:0003700 | Molecular Function | 0.0 | - |
Sma3 | glycine hydroxymethyltransferase activity | GO:0004372 | Molecular Function | 0.0 | - |
Sma3 | poly(U) RNA binding | GO:0008266 | Molecular Function | 0.0 | - |
Sma3 | pyridoxal phosphate binding | GO:0030170 | Molecular Function | 0.0 | - |
Sma3 | sequence-specific DNA binding | GO:0043565 | Molecular Function | 0.0 | - |
Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
Sma3 | glycine metabolic process | GO:0006544 | Biological Process | 0.0 | - |
Sma3 | L-serine metabolic process | GO:0006563 | Biological Process | 0.0 | - |
Sma3 | one-carbon metabolic process | GO:0006730 | Biological Process | 0.0 | - |
Sma3 | oxygen and reactive oxygen species metabolic process | GO:0006800 | Biological Process | 0.0 | - |
Sma3 | response to cold | GO:0009409 | Biological Process | 0.0 | - |
Sma3 | plant-type hypersensitive response | GO:0009626 | Biological Process | 0.0 | - |
Sma3 | photorespiration | GO:0009853 | Biological Process | 0.0 | - |
Sma3 | polar nucleus fusion | GO:0010197 | Biological Process | 0.0 | - |
Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Serine hydroxymethyltransferase | IPR001085 | - | 0.0 | - |
Sma3 | Transcription factor, MADS-box | IPR002100 | - | 0.0 | - |
Sma3 | Transcription factor, K-box | IPR002487 | - | 0.0 | - |
Sma3 | Pyridoxal phosphate-dependent transferase, major region, subdomain 1 | IPR015421 | - | 0.0 | - |
Sma3 | Pyridoxal phosphate-dependent transferase, major region, subdomain 2 | IPR015422 | - | 0.0 | - |
Sma3 | WD40 repeat, conserved site | IPR019775 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G26780.3 | SHM2 serine hydroxymethyltransferase 2 chr5:9418299-9421725 FORWARD LENGTH=533 | 1.0e-15 | 100% |
RefSeq | Arabidopsis thaliana | NP_851080.1 | serine hydroxymethyltransferase 2 [Arabidopsis thaliana] | 1.0e-15 | 100% |
RefSeq | Populus trichocarpa | XP_002302357.1 | precursor of transferase serine hydroxymethyltransferase 3 [Populus trichocarpa] | 3.0e-15 | 96% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NUX0
Fln msg: Distance to subject end: 403 aas, your sequence is shorter than subject: 32 - 519
Fln protein:
E
Protein Length:
33
Fln nts:
G
Fln Alignment:
biogeco3_euler_11122___ENFTSLSVMQAVGSVMTNKYSEGYPGARYYGG
A9NUX0________________ENFTSLSVMQAVGSVMTNKYSEGYPGARYYGG
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain