|
||||||
|
UniGene Name: sp_v3.0_unigene208783
Length: 246 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene208783
G |
|
Ace file of the UniGene sp_v3.0_unigene208783
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | RuBisCO large subunit-binding protein subunit beta, chloroplastic n=6 Tax=core eudicotyledons RepID=RUBB_PEA | - | - | 2.0e-31 | 95% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 97% |
| Sma3 | RuBisCO large subunit-binding protein subunit beta, chloroplastic | - | - | 3.515e-11 | - |
| Source | Gene names |
|---|---|
| Sma3 | AT1G55490; AT5G56500; At1g26230; At1g55490; At3g13470; At5g56500; CHLREDRAFT_132530; CHLREDRAFT_136288; CPN60; CPN60B1; CPN60B2; GSVIVT00021181001; GSVIVT00024837001; GSVIVT00034341001; MICPUCDRAFT_33182; OJ1435_F07.26; Os02g0102900; Os06g0114000; OsI_054 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleolus | GO:0005730 | Cellular Component | 0.0 | - |
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | cytosolic ribosome | GO:0022626 | Cellular Component | 0.0 | - |
| Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | protein folding | GO:0006457 | Biological Process | 0.0 | - |
| Sma3 | cell death | GO:0008219 | Biological Process | 0.0 | - |
| Sma3 | response to cold | GO:0009409 | Biological Process | 0.0 | - |
| Sma3 | systemic acquired resistance | GO:0009627 | Biological Process | 0.0 | - |
| Sma3 | cellular protein metabolic process | GO:0044267 | Biological Process | 0.0 | - |
| Sma3 | chaperone mediated protein folding requiring cofactor | GO:0051085 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Chaperonin Cpn60 | IPR001844 | - | 0.0 | - |
| Sma3 | Chaperonin Cpn60/TCP-1 | IPR002423 | - | 0.0 | - |
| Sma3 | Chaperone, tailless complex polypeptide 1 | IPR017998 | - | 0.0 | - |
| Sma3 | Chaperonin Cpn60, conserved site | IPR018370 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G56500.1 | TCP-1/cpn60 chaperonin family protein chr5:22874058-22876966 FORWARD LENGTH=597 | 1.0e-32 | 93% |
| RefSeq | Arabidopsis thaliana | NP_200461.4 | TCP-1/cpn60 chaperonin family protein [Arabidopsis thaliana] | 1.0e-32 | 93% |
| RefSeq | Populus trichocarpa | XP_002303983.1 | predicted protein [Populus trichocarpa] | 2.0e-32 | 89% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NV22
Fln msg: Warning!, your query overlaps and the subject is separated, Distance to subject end: 43 aas, your sequence is shorter than subject: 82 - 617
Fln protein:
A
Protein Length:
83
Fln nts:
G
Fln Alignment:
biogeco3_euler_915___AVEEGIVVGGGCSLLRLASKVDAIRDTLENDEQKxxxxxxxxxxxxxxKRIAKNAGVNGSVVAEKVLSSDNPKYGYNAATGKYEDLMAAGIIDPTKV
A9NV22________________AVEEGIVVGGGCALLRLASKVDAIRDTLENDEQKxxxxxxxxxxxxxxKLIAKNAGVNGSVVVEKVLSSDDPKYGYNAATGKYEDLMAAGIIDPTKV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
