UniGene Name: sp_v3.0_unigene208419
Length: 213 nt
UniGene Fasta |
---|
>sp_v3.0_unigene208419
A |
Ace file of the UniGene sp_v3.0_unigene208419 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | PREDICTED: similar to casein kinase I delta [Strongylocentrotus purpuratus] ref|XP_001191450.1| PREDICTED: similar to casein kinase I delta [Strongylocentrotus purpuratus] | - | - | 3.0e-25 | 85% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 82% |
Sma3 | Putative casein kinase I | - | - | 7.054e-19 | - |
Source | Gene names |
---|---|
Sma3 | ADK1; AT4g08800; AT4g14340; AT4g28540; AT4g28860; AT4g28880; At1g03930; At1g04440; At1g72710; At1g72710/F28P22.10; At2g19470; At3g23340; At4g08800; At4g14340; At4g26100; At4g28540; At4g28860; At4g28880; At4g28880/F16A16_10; At5g43320; At5g44100; At5g57015 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | plasmodesma | GO:0009506 | Cellular Component | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
Sma3 | protein kinase activity | GO:0004672 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | kinase activity | GO:0016301 | Molecular Function | 0.0 | - |
Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Reverse transcriptase | IPR000477 | - | 0.0 | - |
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Alpha-isopropylmalate/homocitrate synthase, conserved site | IPR002034 | - | 0.0 | - |
Sma3 | Domain of unknown function DUF71, ATP-binding domain | IPR002761 | - | 0.0 | - |
Sma3 | Endonuclease/exonuclease/phosphatase | IPR005135 | - | 0.0 | - |
Sma3 | YjgF/Yer057p/UK114 family | IPR006175 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | Endoribonuclease L-PSP/chorismate mutase-like | IPR013813 | - | 0.0 | - |
Sma3 | Rossmann-like alpha/beta/alpha sandwich fold | IPR014729 | - | 0.0 | - |
Sma3 | IPR015706 | - | 0.0 | - | |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G23340.1 | ckl10 casein kinase I-like 10 chr3:8351047-8353791 FORWARD LENGTH=442 | 2.0e-31 | 80% |
RefSeq | Arabidopsis thaliana | NP_188976.1 | casein kinase 1 [Arabidopsis thaliana] | 2.0e-31 | 80% |
RefSeq | Populus trichocarpa | XP_002302034.1 | predicted protein [Populus trichocarpa] | 1.0e-31 | 81% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LR36
Fln msg: Distance to subject end: 239 aas, your sequence is shorter than subject: 70 - 479
Fln protein:
N
Protein Length:
71
Fln nts:
A
Fln Alignment:
biogeco2_euler_14819___NLTGTARYASINTHLGIEQSRRDDLESLGYMLMYFLRGSLPWQGLKAWEPKSRSMKKISEEKMSTPIEVL
B8LR36________________NLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFLRGSLPWQGLKA-GTKKQKYDKISEKKVSTPFEVL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain