UniGene Name: sp_v3.0_unigene208135
Length: 143 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene208135
G |
Ace file of the UniGene sp_v3.0_unigene208135 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Glyceraldehyde-3-phosphate dehydrogenase, cytosolic n=4 Tax=Spermatophyta RepID=G3PC_GINBI | - | - | 6.0e-16 | 80% |
| FL-Next | sp=Glyceraldehyde-3-phosphate dehydrogenase, cytosolic; Pinus sylvestris (Scots pine). | - | - | 0.0 | 81% |
| Sma3 | Glyceraldehyde-3-phosphate dehydrogenase | - | - | 1.107e-30 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating). | EC:1.2.1.12 | - | 1.523e-27 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glycolysis / Gluconeogenesis | 00010 | 1.523e-27 | % | |
| Sma3 | Biosynthesis of phenylpropanoids | 01061 | 1.523e-27 | % | |
| Sma3 | Biosynthesis of terpenoids and steroids | 01062 | 1.523e-27 | % | |
| Sma3 | Biosynthesis of alkaloids derived from shikimate pathway | 01063 | 1.523e-27 | % | |
| Sma3 | Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid | 01064 | 1.523e-27 | % | |
| Sma3 | Biosynthesis of alkaloids derived from histidine and purine | 01065 | 1.523e-27 | % | |
| Sma3 | Biosynthesis of alkaloids derived from terpenoid and polyketide | 01066 | 1.523e-27 | % | |
| Sma3 | Biosynthesis of plant hormones | 01070 | 1.523e-27 | % | |
| Sma3 | Metabolic pathways | 01100 | 1.523e-27 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 1.523e-27 | % |
| Source | Gene names |
|---|---|
| Sma3 | G3PDH; G3pdh; GAPC; GAPC1; GAPC3; GAPDH; GAPDH2; GAPDH_1; GPC3; GSVIVT00009717001; GSVIVT00035097001; GapC; GapCp; GapCp1; MICPUCDRAFT_27359; MICPUN_104954; NaGAPDH; OJ000223_09.15; OJ1791_B03.34; Os02g0601300; Os04g0486600; Os06g0666600; OsI_07948; OsJ_0 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity | GO:0004365 | Molecular Function | 0.0 | - |
| Sma3 | NAD binding | GO:0051287 | Molecular Function | 0.0 | - |
| Sma3 | glucose metabolic process | GO:0006006 | Biological Process | 0.0 | - |
| Sma3 | glycolysis | GO:0006096 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | IPR000173 | - | 0.0 | - | |
| Sma3 | Glyceraldehyde-3-phosphate dehydrogenase, type I | IPR006424 | - | 0.0 | - |
| Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
| Sma3 | CS domain | IPR017447 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G04120.1 | GAPC, GAPC-1, GAPC1 glyceraldehyde-3-phosphate dehydrogenase C subunit 1 chr3:1081077-1083131 FORWARD LENGTH=338 | 5.0e-19 | 72% |
| RefSeq | Arabidopsis thaliana | NP_001077530.1 | glyceraldehyde 3-phosphate dehydrogenase [Arabidopsis thaliana] | 5.0e-19 | 72% |
| RefSeq | Populus trichocarpa | XP_002321679.1 | predicted protein [Populus trichocarpa] | 9.0e-20 | 75% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: P34924
Fln msg: Distance to subject end: 82 aas, your sequence is shorter than subject: 47 - 340
Fln protein:
D
Protein Length:
48
Fln nts:
G
Fln Alignment:
biogeco1_euler_22366___DWRGGRGAGFNIIPSSTGAAKAVGKV-----------AFRVPTPDVSVVDLTVRLEKS
P34924________________DWRGGRGAGFNIIPSSTGAAKAVGKVLPALNGKLTGMAFRVPTPDVSVVDLTVRLEKS

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta (sense)