UniGene Name: sp_v3.0_unigene208082
Length: 195 nt
UniGene Fasta |
---|
>sp_v3.0_unigene208082
A |
Ace file of the UniGene sp_v3.0_unigene208082 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Probable trans-2-enoyl-CoA reductase, mitochondrial n=3 Tax=Arabidopsis RepID=MECR_ARATH | - | - | 5.0e-19 | 70% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 95% |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Trans-2-enoyl-CoA reductase (NADPH). | EC:1.3.1.38 | - | 1.656e-09 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Fatty acid elongation in mitochondria | 00062 | 1.656e-09 | % | |
Sma3 | Biosynthesis of unsaturated fatty acids | 01040 | 1.656e-09 | % | |
Sma3 | Metabolic pathways | 01100 | 1.656e-09 | % |
Source | Gene names |
---|---|
Sma3 | At3g45770; GSVIVT00024445001; LOC_Os12g01160; Os11g0102500; Os12g0102100; OsI_37110; OsJ_34892; PHYPADRAFT_118360; POPTRDRAFT_1116878; RCOM_0327490; T6D9.100; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
Sma3 | trans-2-enoyl-CoA reductase (NADPH) activity | GO:0019166 | Molecular Function | 0.0 | - |
Sma3 | fatty acid biosynthetic process | GO:0006633 | Biological Process | 0.0 | - |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Alcohol dehydrogenase superfamily, zinc-type | IPR002085 | - | 0.0 | - |
Sma3 | Alcohol dehydrogenase, C-terminal | IPR013149 | - | 0.0 | - |
Sma3 | Alcohol dehydrogenase GroES-like | IPR013154 | - | 0.0 | - |
Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G45770.1 | Polyketide synthase, enoylreductase family protein chr3:16805753-16807774 REVERSE LENGTH=375 | 1.0e-25 | 70% |
RefSeq | Arabidopsis thaliana | NP_974388.1 | putative trans-2-enoyl-CoA reductase [Arabidopsis thaliana] | 1.0e-25 | 70% |
RefSeq | Populus trichocarpa | XP_002330876.1 | predicted protein [Populus trichocarpa] | 2.0e-23 | 69% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5AAL2
Fln msg: Distance to subject end: 30 aas, your sequence is shorter than subject: 65 - 387
Fln protein:
T
Protein Length:
66
Fln nts:
A
Fln Alignment:
biogeco1_euler_10596___TMVTYGGMSKKPITVSTSSFIFKDLRLRGYWLQNWTNLHTVNEFKPMTDYLLRLVRDGQLKYIME
D5AAL2________________TMVTYGGMSKKPITVSTSSFIFKDLRLRGYWMQNWINLHTVNEFKPMTDYLLRLVRDGQLKYVME
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain