SustainPineDB

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene207128

Length: 764 nt

This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense

UniGene Fasta (sense)

Ace file of the UniGene sp_v3.0_unigene207128 (antisense)

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Phenylcoumaran benzylic ether reductase n=6 Tax=Pinaceae RepID=O81651_PINTA	-	-	5.0e-32	69%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	68%
Sma3	Pterocarpan reductase	-	-	3.007e-15	-

Source	ECs	Term	Type	e value	Identity
Sma3	Oxidoreductases, Acting on the CH-CH group of donors, With NAD(+) or NADP(+) as acceptor.	EC:1.3.1.-	-	3.629e-06	-

Source	KEGGs	Term	e value	Identity
Sma3	Fatty acid biosynthesis	00061	3.629e-06	%
Sma3	Phenylalanine metabolism	00360	3.629e-06	%
Sma3	Chlorocyclohexane and chlorobenzene degradation	00361	3.629e-06	%
Sma3	Fluorobenzoate degradation	00364	3.629e-06	%
Sma3	Tryptophan metabolism	00380	3.629e-06	%
Sma3	Xylene degradation	00622	3.629e-06	%
Sma3	Toluene degradation	00623	3.629e-06	%
Sma3	Polycyclic aromatic hydrocarbon degradation	00624	3.629e-06	%
Sma3	Propanoate metabolism	00640	3.629e-06	%
Sma3	Isoflavonoid biosynthesis	00943	3.629e-06	%
Sma3	Biosynthesis of unsaturated fatty acids	01040	3.629e-06	%
Sma3	Metabolic pathways	01100	3.629e-06	%

Source	Gene names
Sma3	A622; A622L; At1g75280; BETV6; BETV6.0102; DDCBER1; F22H5.17; GSVIVT00014594001; GSVIVT00036356001; GSVIVT00036357001; GSVIVT00036358001; GSVIVT00036361001; GSVIVT00036363001; GSVIVT00036364001; GSVIVT00037049001; IFR1; IFR2; IRL1; OsI_01074; OsI_01076; O

Source	GOs	Term	Type	Identity
Sma3	cytoplasm	GO:0005737	Cellular Component	-
Sma3	plasma membrane	GO:0005886	Cellular Component	-
Sma3	catalytic activity	GO:0003824	Molecular Function	-
Sma3	binding	GO:0005488	Molecular Function	-
Sma3	oxidoreductase activity	GO:0016491	Molecular Function	-
Sma3	transcription repressor activity	GO:0016564	Molecular Function	-
Sma3	regulation of nitrogen utilization	GO:0006808	Biological Process	-
Sma3	response to oxidative stress	GO:0006979	Biological Process	-
Sma3	response to cadmium ion	GO:0046686	Biological Process	-
Sma3	oxidation-reduction process	GO:0055114	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Cecropin	IPR000875	-	-
Sma3	NmrA-like	IPR008030	-	-
Sma3	Histidine phosphatase superfamily, clade-1	IPR013078	-	-
Sma3	NAD(P)-binding domain	IPR016040	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT1G75280.1	NmrA-like negative transcriptional regulator family protein chr1:28252030-28253355 FORWARD LENGTH=310	6.0e-26	48%
RefSeq	Arabidopsis thaliana	NP_565107.1	Isoflavone reductase-P3 [Arabidopsis thaliana]	8.0e-26	48%
RefSeq	Populus trichocarpa	XP_002330574.1	phenylcoumaran benzylic ether reductase 4 [Populus trichocarpa]	2.0e-26	52%

Full-Lengther Next Prediction

Fln status: Putative Complete

Fln database: coniferopsida.fasta

Fln subject: B8LKD4

Fln msg: Warning!, your query overlaps and the subject is separated, your sequence is shorter than subject: 166 - 319. Was predicted as Complete, but is very much shorter than de subject

Fln protein: MASSRNNRILIIGATGYIGRYIAKASLAYGHPTFLLVRESTASSSDSEKAHFLESLKALGANILLGSIEDYASVVEAIKKVDIVISLVGGFMQMSQMNIIKAIKEVxxxxxxxxxxxxxxLACCHFIFLRGNLNNFEIGPHDVEATELYPDVKYTTVEEFLRQSV*

Protein Length: 167

Fln nts: ATCAGGTCATCACTCTAATCTCCAAGATTAAATTATATGCAGCATCTCTCTGTTTCTCTCGTTCTTTGAATCAATTGGCAAGATTGGGCAAA_-_ATGGCAAGCAGCAGGAACAACAGGATCTTGATAATCGGAGCAACAGGCTACATTGGTCGTTATATAGCCAAAGCCAGCCTTGCTTACGGCCATCCTACATTCCTTCTAGTGAGAGAGTCCACGGCTTCTTCTTCTGATTCTGAGAAAGCCCACTTCCTGGAATCCTTGAAGGCCTTAGGTGCTAATATACTCCTTGGATCTATAGAAGATTATGCAAGTGTTGTGGAAGCAATTAAGAAAGTGGACATAGTTATTTCACTTGTAGGGGGGTTTATGCAAATGAGTCAAATGAATATTATCAAAGCAATAAAGGAAGTTxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxTTGGCTTGCTGCCACTTTATTTTCCTGAGAGGGAATTTAAACAATTTTGAAATTGGACCTCATGATGTGGAGGCCACTGAGCTCTACCCGGACGTGAAATACACGACAGTGGAAGAGTTCCTTAGGCAGTCTGTTTAA___AGCCCCTGGCGCTTGGCAGAATAATATAAAGCATGAGTTGCTTTTATCTTTATGCAAGTCTATAATGTGAAGAAGTTGATCAAAGTGTCTGAACAAACAATAAAAATGGAGGAGTTGCTTTTTATGTTTATGCAAGTTTATGAATTAATAATTTATTATGAAAATTCTGACAAAA

Fln Alignment:

AllPine_b_rep_c69573___SSRNNRILIIGATGYIGRYIAKASLAYGHPTFLLVRESTASSSDSEKAHFLESLKALGANILLGSIEDYASVVEAIKKVDIVISLVGGFMQMSQMNIIKAIKEVGNIKMLKPGMKSFxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKYQDAKTWDEKFYLACCHFIFLRGNLNNFEIGPHDVEATELYPDVKYTTVEEFLRQSV
B8LKD4________________TSSKSRILIIGATGFIGRHFTKASLAEGHPTFLLVRDSAASSSP-EKAKLLESFRASGANILQGSLDDYASLVEALKKVDVVISAVGDFQRMSQINLIKAIKEVGNIKRFLPSEFAFxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKIADAQPELMKHYLSVCHYVFMKGDLTNFEIGPHGAEATQLYPNVTYSTVEDFLSRYV

SNPs (tot: 5)

Position	A %	C %	G %	T %	Probability
99	88	11			0.923628
100			25	75	1.0
139		12	87		0.992555
166		85		14	0.993537
559	25		75		0.996478

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain