SustainPineDB

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene206587

Length: 963 nt

UniGene Fasta

Ace file of the UniGene sp_v3.0_unigene206587

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Copia-type polyprotein, putative n=1 Tax=Arabidopsis thaliana RepID=Q9C536_ARATH	-	-	0.0	48%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	51%
Sma3	Retrotransposon protein, putative, Ty1-copia subclass	-	-	1.132e-14	-

Source	Gene names
Sma3	At2g05390; At2g13930; At2g15650; At2g15700; At2g17490; At2g21460; F11I4_21; GSVIVT00019821001; H0306F03.15; H0413E07.4; LOC_Os03g26290; LOC_Os03g27910; LOC_Os03g46450; LOC_Os03g61660; LOC_Os10g01450; LOC_Os10g01750; LOC_Os10g34120; LOC_Os11g05840; LOC_Os1

Source	GOs	Term	Type	Identity
Sma3	intracellular	GO:0005622	Cellular Component	-
Sma3	nucleus	GO:0005634	Cellular Component	-
Sma3	membrane	GO:0016020	Cellular Component	-
Sma3	nucleotide binding	GO:0000166	Molecular Function	-
Sma3	DNA binding	GO:0003677	Molecular Function	-
Sma3	sequence-specific DNA binding transcription factor activity	GO:0003700	Molecular Function	-
Sma3	RNA-directed DNA polymerase activity	GO:0003964	Molecular Function	-
Sma3	aspartic-type endopeptidase activity	GO:0004190	Molecular Function	-
Sma3	endonuclease activity	GO:0004519	Molecular Function	-
Sma3	exonuclease activity	GO:0004527	Molecular Function	-
Sma3	peroxidase activity	GO:0004601	Molecular Function	-
Sma3	protein binding	GO:0005515	Molecular Function	-
Sma3	zinc ion binding	GO:0008270	Molecular Function	-
Sma3	nucleoside-triphosphatase activity	GO:0017111	Molecular Function	-
Sma3	heme binding	GO:0020037	Molecular Function	-
Sma3	regulation of transcription, DNA-dependent	GO:0006355	Biological Process	-
Sma3	response to oxidative stress	GO:0006979	Biological Process	-
Sma3	DNA integration	GO:0015074	Biological Process	-
Sma3	transposition	GO:0032196	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Peptidase, cysteine peptidase active site	IPR000169	-	-
Sma3	Peptidase S8/S53, subtilisin/kexin/sedolisin	IPR000209	-	-
Sma3	CCAAT-binding transcription factor, subunit B	IPR001289	-	-
Sma3	BRCT domain	IPR001357	-	-
Sma3	Integrase, catalytic core	IPR001584	-	-
Sma3	Leucine-rich repeat	IPR001611	-	-
Sma3	F-box domain, cyclin-like	IPR001810	-	-
Sma3	Pleckstrin homology domain	IPR001849	-	-
Sma3	Zinc finger, CCHC-type	IPR001878	-	-
Sma3	Haem peroxidase, plant/fungal/bacterial	IPR002016	-	-
Sma3	Short-chain dehydrogenase/reductase SDR	IPR002198	-	-
Sma3	AAA+ ATPase domain	IPR003593	-	-
Sma3	Putative 5-3 exonuclease	IPR004859	-	-
Sma3	Zinc finger, PMZ-type	IPR006564	-	-
Sma3	Zinc finger, SWIM-type	IPR007527	-	-
Sma3		IPR010256	-	-
Sma3		IPR013084	-	-
Sma3	Reverse transcriptase, RNA-dependent DNA polymerase	IPR013103	-	-
Sma3	ABC-2 type transporter	IPR013525	-	-
Sma3	Acyl-CoA N-acyltransferase	IPR016181	-	-
Sma3	F-box associated interaction domain	IPR017451	-	-
Sma3	Peptidase A2A, retrovirus RVP subgroup	IPR018061	-	-

Full-Lengther Next Prediction

Fln status: N-terminus

Fln database: coniferopsida.fasta

Fln subject: B8LKX7

Fln msg: Separated hits, possible frame ERROR between 119 and 523, Distance to subject end: 93 aas, your sequence is shorter than subject: 304 - 407

Fln protein: MNLLSVSQLQNKDYDVFFNKExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxWIYFLKTKYEVFGRFKEFKALVENLTGKKIKVLRSENGGEYVDKDFTDFCAKEGIRRKWTTPYNPEQNGVAERKNSAIVEVAREMLYDQDMPKFLWAEACNTTIYVQNRSPHRALGKITLERVFTRKTPAVSHFRIFGSLAYCRILR

Protein Length: 305

Fln nts: AAGCAGGGGATGGACTTCATGCAACCAATGTGTTGCATGTGCTAGGATTGGGG_-_ATGAACTTACTTTCCGTATCTCAACTTCAAAACAAGGACTATGATGTTTTCTTCAATAAGGAGAAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxTTGGATCTACTTTCTAAAAACCAAGTATGAGGTTTTTGGTCGATTCAAAGAGTTCAAGGCTCTAGTGGAGAATCTGACAGGAAAGAAGATAAAAGTGTTGCGCTCAGAAAATGGTGGAGAGTATGTTGACAAGGACTTCACTGATTTTTGCGCTAAGGAAGGCATCAGAAGAAAGTGGACAACTCCCTACAATCCGGAGCAGAATGGGGTAGCAGAAAGGAAAAATAGTGCTATTGTGGAAGTAGCTAGGGAAATGCTCTATGATCAGGATATGCCCAAATTCCTATGGGCAGAAGCATGCAACACGACAATTTATGTACAGAATAGGAGTCCACACAGGGCATTGGGTAAAATCACTTTGGAAAGGGTCTTCACTAGGAAGACACCTGCAGTTAGTCATTTCAGGATATTTGGGAGTTTGGCGTATTGCCGTATACTACGG

Fln Alignment:

AllPine_b_rep_c66772___VLGLGMNLLSVSQLQNKDYDVFFNKEKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxWIYFLKTKYEVFGRFKEFKALVENLTGKKIKVLRSENGGEYVDKDFTDFCAKEGIRRKWTTPYNPEQNGVAERKNSAIVEVAREMLYDQDMPKFLWAEACNTTIYVQNRSPHRALGKITLERVFTRKTPAVSHFRIFGSLAYCRI
B8LKX7________________VPNLKSNLLSVNQIANQGYKVEFYKDKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxWVYFLKNKDEVFEKFKEFKAFVEKQSGKSIKILRTDNGKEYVNKEFDHYCKYNGIKREHTVPYTPQQNGVAERKNRTLMEMARCMLHARNMDPKFWAEAINTATYIVNRTPTIAVKHKTPEEAWSRRKPTVSHFKVFGCDVYVHI

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain